Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

30 sentences found for "power"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

3. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

4. Effective use of emphasis can enhance the power and impact of communication.

5. Einstein's work led to the development of technologies such as nuclear power and GPS.

6. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

7. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

8. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

9. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

10. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

11. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

12. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

13. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

14. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

15. Kings have held power throughout human history, from ancient civilizations to modern times.

16. Kings may wield absolute or constitutional power depending on their country's system of government.

17. Knowledge is power.

18. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

19. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

20. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

23. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

24. The king's role is often ceremonial, but he may also have significant political power in some countries.

25. The power of a single act of kindness can be immeasurable in its impact.

26. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

27. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

28. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

29. The United States has a system of federalism, where power is divided between the national government and the individual states

30. The United States is a federal republic, meaning that power is divided between the national government and the individual states

Random Sentences

1. A couple of cars were parked outside the house.

2. Dalawa ang kalan sa bahay namin.

3. Ang aming angkan ay may natatanging kultura at mga paniniwala.

4. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

5. Nakikinig ako sa mga kanta ng Bukas Palad tuwing Linggo sa simbahan.

6. Ano ang nasa ibabaw ng palayan?

7. Ang paggamit ng droga ay maaaring magdulot ng pagkabaliw, paranoia, pagkabalisa, at pagkakaroon ng kawalan ng pag-iingat sa sarili.

8. Mababa ang tubig sa ilog dahil sa tag-init.

9. Kailangan ko umakyat sa room ko.

10. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

11. Hindi ko akalaing may nangahas na gumawa ng ganoong delikadong eksperimento.

12. El agua es el recurso más preciado y debemos conservarlo.

13. Ngayon ka lang makakakaen dito?

14. Sinabi naman ni Apollo ang mga dapat gawin.

15. All these years, I have been striving to live a life of purpose and meaning.

16. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

17. Ang pangungutya ay hindi magbubunga ng maganda.

18. Sa takipsilim kami nagsimulang mag-akyat ng bundok.

19. Ang kabayanihan ni Rizal ay patuloy na pinararangalan sa pamamagitan ng pagdiriwang ng kanyang kaarawan at mga aktibidad sa buong bansa.

20. Maaga dumating ang flight namin.

21. Kapag may tiyaga, may nilaga.

22. Maaaring tumawag siya kay Tess.

23. Papaano ho kung hindi siya?

24. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

25. The telephone has undergone many changes and improvements since its invention

26. Pagkagising ni Leah ay agad na itong naghilamos ng kanyang mukha.

27. Napahinto rin kami dahil kay Jenny.

28. Comer regularmente comidas pequeñas y saludables durante todo el día puede ayudar a mantener niveles de energía estables.

29. Di kalaunan, habang lumalaki ang bata, napapansin nilang ito nagiging salbahe, napakasinungaling at maramot.

30. ¡Buenas noches!

31. Cada nacimiento es un milagro y un regalo especial.

32. Magkano po sa inyo ang yelo?

33. He has fixed the computer.

34. Hindi sila masiyado nakapagusap dahil nagpaalam agad ang dalaga na kailangan na niyang matulog.

35. Kailangan kong lumakas ang aking loob upang maalis ang aking mga agam-agam sa aking mga pangarap.

36.

37. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

38. Gaano karami ang dala mong mangga?

39. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

40. Laganap ang paggamit ng social media sa kabataan ngayon.

41. Has she taken the test yet?

42. "You can't teach an old dog new tricks."

43. Bahay ho na may dalawang palapag.

44. Hindi ko kayang itago ito, gusto kong malaman mo na sana pwede ba kitang mahalin?

45. Deep learning is a type of machine learning that uses neural networks with multiple layers to improve accuracy and efficiency.

46. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

47. Aus den Augen, aus dem Sinn.

48. Bilhan mo ang bata ng Bumili ka ng kendi para

49. Ah ganun ba sabi ko habang naka tingin sa cellphone ko.

50. Los padres experimentan un profundo vínculo emocional con su bebé desde el momento del nacimiento.

Similar Words

powerpointpowers

Recent Searches

galitpowerwowvideofeedback,vampiresnahulinangingitngittabasidea:nalasinginuminearlypangulospendinglulusogpadabogstagepinilingobstaclesbula4thsedentarycomunesnasisilawhumanoiginitgitbinilingpackagingeditorinvolvehulingtechnologies2001ricabornsiksikanpagkaangatdakilangiikutaninterviewingkatolisismountimelybanalpagdamidevicesconvey,pakikipaglabanmaingaybakanayonplayedimbesclearlcdsections,naglabanakapasoktools,railwaysagaw-buhaykumakalansingnaghihirappictureislandpagkakalutodistancespinagmamasdanasocaracterizapakibigyannaalalatransitmaingatmatutonghimutoksalitaagawyunlandbiggestfrieskararatingyonmakakakaenkalalaropaki-drawingnapanoodsiniyasatpagkagustonakatirainvestinganubayanmenucallingdraft,knowguiltyappformmaputiechavemonsignornagpalalimumiiyaknagtatanongpagkakayakaphila-agawannagtagisannag-aalangannag-iyakankadalagahangmedya-agwakumembut-kembotkailanmanmakabilipaghahabimanatilimatagpuanpansamantalafilipinapangangatawannauliniganvaccinesprincipalesmakapalstorymabatonginiindamagbibiladcongratstv-showsbahagyadahilbulalaskesoculturesnaglutonagtaasbumaligtaduniversitypaparusahandiyaryofranciscomatutulogroofstocklalargalabisrespektivenagyayangpatakbongnglalabasisikatalmacenardadaloipagmalaakidialledquarantinesakaygownpanitikande-latalilikomobilitypusainfluencesganidphilosophicalwaitergabimaalwanginintaymulti-billionperwisyowidelysikonasankatapatkontingsapattinikanakasalananfluidityumiwastilaubodilanggabingpaghinginiligawanfamesaymayabanglumulusobisugastillpostcardmabilisbernardo