Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

30 sentences found for "power"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

3. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

4. Effective use of emphasis can enhance the power and impact of communication.

5. Einstein's work led to the development of technologies such as nuclear power and GPS.

6. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

7. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

8. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

9. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

10. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

11. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

12. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

13. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

14. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

15. Kings have held power throughout human history, from ancient civilizations to modern times.

16. Kings may wield absolute or constitutional power depending on their country's system of government.

17. Knowledge is power.

18. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

19. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

20. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

23. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

24. The king's role is often ceremonial, but he may also have significant political power in some countries.

25. The power of a single act of kindness can be immeasurable in its impact.

26. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

27. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

28. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

29. The United States has a system of federalism, where power is divided between the national government and the individual states

30. The United States is a federal republic, meaning that power is divided between the national government and the individual states

Random Sentences

1. Sino ang bumisita kay Maria?

2. They ride their bikes in the park.

3. Nareklamo ko na ho ito pero wala hong sagot.

4. May bakante ho sa ikawalong palapag.

5. Hindi dapat natin ipagkait sa mga kabataan ang agaw-buhay na pagkakataon sa edukasyon.

6. Ang mailap na kaligayahan ay kailangan hanapin ng mabuti.

7. Omelettes are a popular choice for those following a low-carb or high-protein diet.

8. I always wake up early to study because I know the early bird gets the worm.

9. Si Ogor, na kamakailan lamang ay bumabag sa kanya, ang malimit magsisimula ng panunukso.

10. Akin na kamay mo.

11. Ang daming bawal sa mundo.

12. Nangyari pa nagmistulang itong reyna kung utusan ang ama at ina.

13. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

14. Di ko sya maistorbo dahil sya ay nag-aaral pa.

15.

16. Pagkasabi nya nun bigla syang ngumiti agad, Walang bawian.

17. Nag-reply na ako sa email mo sakin.

18. Hindi dapat magbase ng pagpili ng mga kaibigan sa kanilang kababawan, kundi sa kanilang pagkatao.

19. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

20. Mataas sa calcium ang gatas at keso.

21. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

22. Protecting biodiversity is important for the health of ecosystems and the survival of many species.

23. Tengo dolor de articulaciones. (I have joint pain.)

24. Magmula noon nakilala na sa Palawan ang pating.

25. ¿Dónde está el baño?

26. Hinanap ko ang pulotgata sa bukid upang magkaroon ng panghimagas.

27. Users can like, react, or share posts on Facebook to show their engagement and support.

28. Beauty. maya-maya eh sabi ni Maico.

29. Binigyan niya ako ng isang dosenang rosas.

30. Nakatulog ako sa harap ng telebisyon at nagitla ako nang biglang nagtaas ang boses ng mga artista sa palabas.

31. Excuse me, anong tawag mo sakin? nakangiting tanong ko.

32. Nagtagumpay siya sa kanyang agaw-buhay na laban sa kanyang sakit.

33. Isang beses naman ay ang sandok ang hinahanap.

34. My best friend and I share the same birthday.

35. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

36. Kasama ng kanilang mga kapatid, naghihinagpis silang lahat sa pagkawala ng kanilang magulang.

37. Masayang-masaya ang kagubatan.

38. Ailments can be managed through self-care practices, such as meditation or physical therapy.

39. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

40. Der er en række organisationer og programmer, der tilbyder hjælp til mennesker, der kæmper med gamblingafhængighed.

41.

42. Las redes sociales pueden ser un lugar para descubrir nuevos productos y tendencias.

43. Kinabukasan ay nag paalam ulit si Ana na aalis pagtungo sa kagubatan, dahil tinawag daw siya ulit ng nagbigay ng pagkain sa kaniya.

44. Napansin niya ang takot na takot na usa kaya't nagpasya ito na puntahan ito.

45. Musk's SpaceX has successfully launched and landed reusable rockets, lowering the cost of space exploration.

46. Que la pases muy bien

47. Ang pogi ng BF mo Maria, sana-all!

48. Kailan niyo naman balak magpakasal?

49. Mabait na mabait ang nanay niya.

50. Ang daming pulubi sa maynila.

Similar Words

powerpointpowers

Recent Searches

barrierstenpowerreducedfraabeneadverselyfeelboyetpetsatuwidfistsmatandasincescheduleinaliswalletenchantedbelievedputahenotemailelectionmalimitabstainingconcernschefseenbakestandferrercallemphasispagawainrestcontinuesmagkabilangnaroonelectronicsurveysteamitimbumabaresultsulinganibinigaynampalibhasapatingdamitworkingamountplatformbeyondlibagbroadcastsinvolvegenerationsqualitycommunicatebeforemuchflyrawnavigationprogramawhileexamplemakapilingefficientsyncclassesbehaviorthirdexistcurrenthighestwaitrememberamazonaccuracykumukuhasay,mahiyanag-iyakannakakatulongnamumulaklakkakuwentuhanmanamis-namiskagandahagpodcasts,naninirahansakristanhubad-baronagsagawanapakahusaynerohuertonakatapatteknologimagkaharapmawawalastrategiesnaliwanaganencuestasmababangishinihintaylungsodinuulampahiramsakyanwakaspinalambotsementeryoikatlongitinuloshinukaymatalimsisipaintengabigongskyldesamindiseasesmaongnagnakawelvisbecomingwordsnamustpamumunogawaingpulangtuloystruggledgatheringdesdereorganizingbagyoreboundabidolyarpinansinnandiyanformaearlyclassroomcrosseducationalna-curiousleftmanagerrecentwhethernapagtantomagasawangmagpapabunotnagbakasyonbusinessesmagtanghalianfotostumawaggawinmagsunogtumamakamandagpambatangnagyayanglansangansapatosisinusuotano-anodraft,pinakamahalagangkanayangdamdaminpinipilitkuligligtsinaginisingkulisappunosikatibiliisipanngayontumunogsiguradodesarrollardiseasemayamanglalakedialledherramientamaistorbowasteindividualsuntimelyautomation