Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

30 sentences found for "power"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

3. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

4. Effective use of emphasis can enhance the power and impact of communication.

5. Einstein's work led to the development of technologies such as nuclear power and GPS.

6. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

7. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

8. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

9. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

10. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

11. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

12. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

13. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

14. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

15. Kings have held power throughout human history, from ancient civilizations to modern times.

16. Kings may wield absolute or constitutional power depending on their country's system of government.

17. Knowledge is power.

18. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

19. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

20. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

23. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

24. The king's role is often ceremonial, but he may also have significant political power in some countries.

25. The power of a single act of kindness can be immeasurable in its impact.

26. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

27. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

28. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

29. The United States has a system of federalism, where power is divided between the national government and the individual states

30. The United States is a federal republic, meaning that power is divided between the national government and the individual states

Random Sentences

1. This can generate passive income for you, but it does require some capital to get started

2. Nasa kanan ng restawran ang sinehan.

3. Ang mailap na kaharian ay kailangan paghirapan upang mapasakamay.

4. Saan ka nakatira? ang tanong ng pulis.

5. Bigyan mo muna ako ng dahilan kung baket. sabi ko.

6. Nagkalat ang mga adik sa kanto.

7. Huwag magpabaya sa pag-aasikaso ng mga responsibilidad sa tahanan o sa trabaho.

8. She admired the way her grandmother handled difficult situations with grace.

9. Waaa. Ikaw pala salarin kaya ayaw nya sa ospital!

10. Omelettes are a popular choice for those following a low-carb or high-protein diet.

11. Sa mga tono at salita ng kundiman, nabibigyang-pansin ang pag-asa at paglalakbay ng mga pusong nagmamahalan.

12. Les robots dotés d'intelligence artificielle peuvent effectuer des tâches répétitives et dangereuses pour les humains.

13. Sa simoy ng hangin, maaamoy ang mabangong amoy ng damo sa bukid.

14. Some ailments are preventable through vaccinations, such as measles or polio.

15. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

16. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

17. Ang galing nya maglaro ng mobile legends.

18. Naghanda kami ng sorpresa para sa kanya.

19. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

20. Si Dr. John ay isang doktor sa kanilang baryo.

21. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

22. Hinintay kong magsalita si Kuya Patrick sa kabilang linya.

23. The dancers are rehearsing for their performance.

24. Naglaba na ako kahapon.

25. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

26. Mga guro sina G. Santos at Gng. Cruz.

27. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

28. Sana po ay maibalik ko pa ang panahon upang mabigyan sila ng kasiyahan.

29. Isang Pinoy ang nanalo sa international singing competition.

30. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

31. Isang mahahalagang pag-uusap o tagpo ang naganap sa loob ng kabanata, na nagbibigay ng bagong pag-unawa sa mga karakter.

32. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

33. Anong lugar ang pinangyarihan ng insidente?

34. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

35. Sa gitna ng kalsada, napansin ko ang isang maliit na bata na napapalibutan ng matinding pagdidilim.

36. Nagtatanim ako ng mga flowering plants upang magkaroon ng magandang tanawin sa paligid.

37. Bagama't mabait ay mailap ang hayop na ito dahil sa hiya.

38. Narinig ko ang hinagpis ng mga magsasaka dahil sa mababang presyo ng kanilang ani.

39. Ang magnanakaw na kumaripas ng takbo ay nahuli rin sa dulo ng kalsada.

40. Sa aming bakuran, nagtatanim kami ng mga tanim na pampalasa tulad ng luya at sibuyas.

41. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

42. Agama menjadi salah satu faktor yang menguatkan identitas nasional Indonesia dan menjaga kesatuan dalam ker

43. Sarado ang eskuwela sa Sabado at Linggo.

44. May naghubad na ng damit at isinampay na lamang sa balikat.

45. Anong oras gumigising si Cora?

46. Ang takip-silim ay isang panahon kung saan maaari mong maappreciate ang ganda ng kalikasan at ng mga gusali.

47. Me duele el estómago. (My stomach hurts.)

48. Tantangan hidup memberikan kesempatan untuk memperluas kemampuan dan meningkatkan kepercayaan diri.

49. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

50. Sa mga agaw-buhay na pagkakataon, kailangan nating mag-isip nang mabilis at gumawa ng tamang desisyon.

Similar Words

powerpointpowers

Recent Searches

rabepowernagpepekenegosyantesuccessfultanggapintumambadowntumakbonapakalakasanthonyadecuadonagtatamposumuotmagpapapagodeskwelahanbecomingmagkasintahanhalikanpinalayasfacebookkanbonifaciorobinhoodinalokcardfeedback,godtclientspanindawhyreleasedperacommunicationsmgajolibeeincreaseavailablemamataankinikilalanghalikapangalanansinaliksikmultobatangnangyayaribrightprutaskayonaputoldescargarisinalaysaytwo-partymataraydawcarloangkanpagtitindananghihinagumuglongdoble-kararektanggulodeterminasyonbagaywikapakakasalanbilangbigyanmagkaibagayunmandahan-dahanhumblecommunitymakemabibingipagpapasanmagkakapatidkarununganipinaalamkaragatannegativesomethinglibrengeditorpirasokasyanamingoversuffermournedimeldalosskalupimagsimulanakataasmarchantredigeringsakopoperativossagapdailywineinspireipinatutupadinspirasyonmapaibabawhinanaphampaslupakagalakanumisiphamontuwing1970sboracaygetpowersdatungnag-aagawansusmamahalintoolnakalipaswednesdaysinakopsurgeryginilingsharingitlognagsisilbimaynilaatsandaliikawkaklasemaniwalapossiblesequepunomakikikainnagniningningpublished,walangpagbatibumababatindigbatonagpupuntaguhitsocialcountryoktubremulighedergospelmagitinggrinsnalasingnapilingatinggreatgriponararamdamanparangjuanitokanyaharap-harapangkuwadernofilmscultivopananimpinasokmahilighalu-halomaingatmakikinigsiyangnagtagpodisfrutaralangannakikini-kinitakakuwentuhanhanggangmahinahongdalandanibat-ibangdullalikabukinikinamatayjamesanaylabahindidkapalpapagalitangalitdeterioratelawatamadpinapakaintoymerchandisepalabas