Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

30 sentences found for "power"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

3. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

4. Effective use of emphasis can enhance the power and impact of communication.

5. Einstein's work led to the development of technologies such as nuclear power and GPS.

6. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

7. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

8. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

9. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

10. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

11. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

12. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

13. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

14. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

15. Kings have held power throughout human history, from ancient civilizations to modern times.

16. Kings may wield absolute or constitutional power depending on their country's system of government.

17. Knowledge is power.

18. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

19. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

20. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

23. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

24. The king's role is often ceremonial, but he may also have significant political power in some countries.

25. The power of a single act of kindness can be immeasurable in its impact.

26. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

27. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

28. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

29. The United States has a system of federalism, where power is divided between the national government and the individual states

30. The United States is a federal republic, meaning that power is divided between the national government and the individual states

Random Sentences

1. Nasa ganito siyang kalagayan nang bigla niyang maramdaman ang isang ubos-lakas na sipa sa kanyang pigi.

2. Pull yourself together and show some professionalism.

3. Matagal na kitang pinapanood at ngayon lang ako maglalabas ng katotohanan - may gusto ako sa iyo.

4. El estudiante con el peinado raro está llamando la atención de sus compañeros.

5. Kumain na ako pero gutom pa rin ako.

6. Kaninang bandang alas-diyes ng umaga.

7. Hendes personlighed er så fascinerende, at jeg ikke kan lade være med at tale med hende. (Her personality is so fascinating that I can't help but talk to her.)

8. She's always creating drama over nothing - it's just a storm in a teacup.

9. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

10. Ang galing nya maglaro ng mobile legends.

11. I know I should have started studying earlier, but better late than never, right?

12. Marahil ay hindi pa sapat ang oras na nakalaan para matapos ang proyekto.

13. The existence of God has been a subject of debate among philosophers, theologians, and scientists for centuries.

14. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

15. Agad niya itong kinuha at isinaboy sa paligid ng salamangkera.

16. Hindi siya nag-aral para sa pagsusulit, samakatuwid, bumagsak siya.

17. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

18. Hinihiling ko lang sana na sa aking pagpanaw ay kunin mo ang aking puso, sunugin mo, at ilagay sa banga ang abo nito.

19. Sige na. Kami na lang bahala dito. sabi sa akin ni Grace

20. Mabibingi ka sa ingay ng kulog.

21. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

22. Nagpakita sa Datu ang Dakilang Bathala at ipinaalam sa ama na ang kanyang anak ay mabubuhay ng labing-siyam na taon lamang.

23. El maíz necesita mucha agua para crecer y producir una buena cosecha

24. Hindi ko kayang hindi sabihin sa iyo, sana pwede ba kitang mahalin?

25. Napahinto kami sa pag lalakad nung nakatapat na namin sila.

26.

27. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

28. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

29. La desigualdad económica y social contribuye a la pobreza de las personas.

30. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

31. Naglabas ng artikulo ang pahayagan ukol sa epekto ng social media sa kabataan.

32. The hospital had a special isolation ward for patients with pneumonia.

33. Isang araw, kararating pa lang ng mag-asawa mula sa pagtitinda ng gulay, galing sa kuwarto ay lumabas si Aya at hiningi ang ipinagbiling prutas.

34. La obra de arte abstracto en la galería tiene una belleza sublime que despierta la imaginación.

35. Waring nag-aalinlangan siyang sagutin ang tanong ng guro.

36. Ang sugal ay isang maling paghahangad ng mga tao na magkaroon ng mabilis na yaman.

37. Ang rebolusyon ay bunga ng pagkamulat ng mga Pilipino kontra kastila.

38. Joshua, kumusta ang pakiramdam mo?

39. Beauty ito na oh. nakangiting sabi niya.

40. Pinaluto ko ang adobo sa nanay ko.

41. She is designing a new website.

42. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

43. Les écoles offrent une variété d'activités parascolaires telles que le sport, la musique et le théâtre.

44. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

45. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

46. Ang mga bayani ay nagtutulungan upang maipagtanggol ang bayan laban sa mga banta at kahirapan.

47. Maaaring magdulot ng agam-agam ang mga suliraning pang-ekonomiya tulad ng kahirapan at pagtaas ng presyo ng mga bilihin.

48. Mahabang pangungusap ang isinulat ni Lito sa pisara.

49. Ang paggamit ng droga ay hindi lamang nakakasira ng kalusugan ng isang tao, kundi maaari rin itong magdulot ng epekto sa buong lipunan.

50. Ano ang mga ginawa niya sa isla?

Similar Words

powerpointpowers

Recent Searches

powerayudaumiilingtumambadgumagalaw-galawhingalramdamguitarrahumanokutsaritangmayhojasbundokpanunuksotaun-taonpasswordcontent,nag-iisangprogramming,trafficrelativelykuripotpinangalanangnalugodpaninigasnag-aalalangeskuwelamagkakagustolumalangoynanlilisikmananakawnananalongkatuwaanlookedbahaypinagawamakikituloghoneymoonmangahasmagbibigayabut-abotsizenahintakutanarabiamakausapkasamapisarasabongalanganmaaaricompositoresmataaasgarbansosresortadoptedmansanaspinagsulatoncemesangkingtatlongpagdamidollarneverbroadcastsalismayabongsesameanungatentoabenebillwestlegendsbobobecomedagaanimoyusamagdapag-iwanpagluluksananinirahanpodcasts,nagsisipag-uwiangobernadordistansyamakalaglag-pantybiocombustiblessaritaflyvemaskinerestudyantemensajespamahalaanpinabayaantumahimikenergy-coalnakasandigpagkapasokrenacentistarememberhinimas-himasmonitorsasayawinbastakwenta-kwentamag-asawat-shirtpapagalitankatawanghealthiersang-ayonreserbasyonkinasisindakankalabawyakapinsinaliksikpinaghatidannagpakunotmahahaliknagtakapioneerpinapataposnakabluemarketingnaglaonnaiyakpasyenteistasyonnaghihirapmakawalanangyarinagsuotnakasakitkamiasbumagsakemnerabutanbayannaglutomahigithinampasunconventionalnatalosakopnuevoampliaumokayemocionalbanalnaggalapwedengmanakbobefolkningenattorneykatolisismotagpiangisusuot1970sdireksyonsugatangapelyidotuloy-tuloycalidadkakayanangbutosikipgymrememberedsinisinatitiraadmired3hrskainanninyopinatiradeterminasyoninvitation1960smachinesmatipunoalakgigisingaaisshpaksabusymaskimataraylipadwasteiconscombinedpublishing,sumingitsiglopagka-maktolmaarimaluwanggatheringresignation