Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "nuclear"

1. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

2. Einstein's work led to the development of technologies such as nuclear power and GPS.

3. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

4. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Palibhasa ay may kakaibang pagtingin sa mga bagay dahil sa kanyang malawak na kaalaman at pag-unawa.

2. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

3. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

4. Ok ka lang ba?

5. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

6. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

7. Masarap higupin ang sinigang na may maraming gulay.

8. ¿Dónde vives?

9. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

10. En invierno, se encienden chimeneas y estufas para mantener el calor en las casas.

11. Doctor Strange is a sorcerer who can manipulate magic and traverse different dimensions.

12. Walang telebisyon sa kuwarto ni Fiona.

13. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

14. Ano ka ba. Mas mahalaga ka naman sa dota noh.

15. Ang mais ay tumutubo nang mabuti sa mainit na panahon, at dapat mong panatilihin ang lupa malambot at madulas sa pamamagitan ng regular na pag-irrigate

16. The project gained momentum after the team received funding.

17. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

18. Samahan mo muna ako kahit saglit.

19. Tulad ng dapat asahan, bumuhos na ang malakas na ulan.

20. Pupunta si Mario sa tabing-dagat sa hapon.

21. Coffee is a popular beverage consumed by millions of people worldwide.

22. Ang mga NGO ay nag-aapuhap ng donasyon upang matulungan ang mga batang ulila.

23. Hindi ko alam kung saan ito mag-uumpisa, pero may gusto ako sa iyo.

24. Ang mga ibon ay wala nga namang mga pangil tulad nila kaya isinama din nila ito sa pagdiriwang.

25. All is fair in love and war.

26. Nalaki ang mga mata ni Mica sa sinabi ni Maico.

27. Hindi dapat natin balewalain ang pag-unlad ng ating komunidad, samakatuwid.

28. Det er en stor milepæl at blive kvinde, og det kan fejres på mange forskellige måder.

29. Pagtatanim at pagbebenta ng gulay ang kinabubuhay ng magasawang Waldo at Busyang na parehong masipag at mabait.

30. El nacimiento de un bebé es un momento de felicidad compartida con familiares y amigos.

31. Congress is divided into two chambers: the Senate and the House of Representatives

32. Masakit mang tanggapin, sa pamilya pa rin ang tatak ng iyong pagkatao.

33. Halos gawin na siyang prinsesa ng mga ito.

34. Holding onto grudges and refusing to forgive can weigh us down emotionally and prevent personal growth.

35. The backpack was designed to be lightweight for hikers, yet durable enough to withstand rough terrain.

36. Malapit na ang araw ng kalayaan.

37. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

38. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

39. Kailangan nating magbago ng mga lumang gawi, datapapwat ay mahirap ito gawin dahil sa kawalan ng disiplina ng iba.

40. Sino ang pupunta sa bahay ni Marilou?

41. The experience of bungee jumping was both terrifying and euphoric.

42. Nang maglakad ako sa tabing-dagat, nakakita ako ng mga maliliit na alon na mayabong na puting espuma.

43. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

44. Después de leer el libro, escribí una reseña en línea.

45. Ako ay nagtatanim ng mga succulent plants sa aking munting terrarium.

46. Madalas lasing si itay.

47. Ang paborito niyang laruan ay Beyblade.

48. Ano ang nahulog mula sa puno?

49. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

50. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

Recent Searches

classroomnamenuclearpaslitharmfulheimainitcommunicationtripmapakalipasokprofessionalhandamitcoatlulusogoutpostcebumapaikotsinongcuentanpowerwidespreadmajordrayberduriipinabalikkaringhamakoliviafakebienjacepaypracticesoffentliginvolveinternalissuesdigitalmakesknowimagingelectronicpossibletelevisedislabornpromotingsedentarydecisionsclassessyncstringprogramsactorspreadaffectstructurethirdmethodspackagingryanayanheftynilulonsementobesespangungutyaautomaticadaptabilityinaapimagkahawaksilapaghangahahatolkananumiibigstorytaximahabolhinanakitagilapupuntahanatensyonkombinationfatherpagsisisisnaclockmurangsaidbarrierspasanditoumiinitpalagingtsaatransparentiinuminaddingactingaudittogetherpasswordellencountlessmagkakaanaknagpakitanapakagandangmarahilbodegapaglalayagmusicianmagpalibredalagahumayoprimerasconocidoskagandahanmbaloraisedmaratingtakeexpectationsmagkakaroonbumangonmatiwasaybiocombustiblesmagbagong-anyonapakahusaypapagalitanmaihaharapmaskarapakakasalancommercialunconventionalsiemprepaketepinigilankundimangumagalaw-galawmagtatagalformatnakaliliyongmagsasalitakategori,pagluluksadingginewansasayawinmakangitinakahigangmakakawawapapanhiknakapagsabinagpipikniknag-iinomtiniradornamulatnakakasamanakatayonakumbinsimagkakailalumalakipagpasensyahanmanlalakbaymarketplacespare-parehonagliliyabpagpapatubomakapangyarihangnaglalatangnanghahapdimagsalitanakaupomakuhangbayawakkusinerotumagalkumikilosmagulayawdiscipliner,presence,nanlakiiwinasiwasmakasilongnagreklamomagpapagupitinasikasopinagkiskissaritanakuhangminu-minutonasasabihankinauupuantatawagannangangaralnahuhumalingtatlumpung