Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "nuclear"

1. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

2. Einstein's work led to the development of technologies such as nuclear power and GPS.

3. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

4. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Las hojas de los árboles cambian de color en otoño.

2. He has been building a treehouse for his kids.

3. Scissors are commonly used for cutting paper, fabric, and other materials.

4. Sa Pilipinas ako isinilang.

5. Ang laki ng wedding cake na ginawa ng kanyang ate.

6. Maputi si Kano, kaya ganito ang tawag dito sa kanilang pook.

7. Kucing di Indonesia adalah hewan yang sering menjadi teman dan sahabat bagi pemiliknya.

8. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

9. Maiba ako Ikaw, saan ka magpa-Pasko?

10. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

11. May naghubad na ng damit at isinampay na lamang sa balikat.

12. The momentum of the wave carried the surfer towards the shore.

13. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

14. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

15. Libre ba si Carol sa Martes ng gabi?

16. Los blogs y los vlogs son una forma popular de compartir información en línea.

17. She speaks three languages fluently.

18. When in Rome, do as the Romans do.

19. Kebahagiaan bisa ditemukan dalam momen-momen kecil sehari-hari.

20. The website's design is sleek and modern, making it visually appealing to users.

21. Paliparin ang kamalayan.

22. Football is also known as soccer in some countries, particularly in the United States.

23. "Mahal kita," ani ng binata sa dalagang kanyang nililigawan.

24. Aus den Augen, aus dem Sinn.

25. She prepares breakfast for the family.

26. They do not eat meat.

27. Ang mga nagtatagumpay sa negosyo ay madalas na itinuring bilang mga modelo ng tagumpay at inspirasyon para sa iba.

28. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

29. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

30. Kung walang panget, walang pagbabasehan ng ganda niyo!

31. Mathematics is a language used to describe and solve complex problems.

32. Les employeurs offrent des formations pour améliorer les compétences des travailleurs.

33. Ang pag-asa ay nagbibigay ng mga oportunidad para sa mga tao upang maabot ang kanilang mga pangarap at mga layunin sa buhay.

34. Mayaman ang amo ni Lando.

35. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

36. Es freut mich, Sie kennenzulernen. - Nice to meet you.

37. Makakasahod na rin ako, sabi niya sa sarili.

38. The basketball court is divided into two halves, with each team playing offense and defense alternately.

39. Kailangan mong higupin ang gamot gamit ang straw.

40. Si Hidilyn Diaz ay tinawag na “Pambansang Bayani” sa larangan ng palakasan.

41. Inirekumenda ng guro na magsagawa kami ng mga field trip upang mas mapalawak ang aming kaalaman.

42. Los amigos que tenemos desde la infancia suelen ser los más cercanos y leales.

43. Sinikap niyang kumbinsihin ang mga katutubo upang maging Katoliko.

44. May grupo ng aktibista sa EDSA.

45. En algunos países, el Día de San Valentín se celebra como el Día de la Amistad y el Amor.

46. Bakit sumakit ang tiyan ni Tonyo?

47. Nagkakatipun-tipon ang mga ito.

48. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

49. Nakakamangha ang paglalagay ng pulotgata sa bao ng niyog upang makagawa ng kakanin.

50. Lumaking masayahin si Rabona.

Recent Searches

bumugadelenuclearellateksticonlulusogkararatingmakapagempakemallsstudentoverviewbinge-watchingintobooksbroadbakeceshighdollarconsiderartipidlockdownsulingandevicesroomawaremakeslearnmalakingfeedbackappgraduationrelevantdoonupworkpresentaprogressincludecertainguidetypesbetweenlasingamazonstyrergeneratepagkakapagsalitanag-uumigtingtsinatonettepedromerrymateryalesnag-emaildomingotherapygandahanagwadorsinipangmaihaharapsundaefestivalesbuung-buokawalankanilaakingperoaregladoparaangbutastillnag-aalangankasintahanumiinommabuhaykumakainkaliwapagkainnabigaymagkabilangkristoumibigtilakaninonghealthforskelmatamiskinakabahancigarettenapapatinginkasaysayannaka-smirkbusiness:naggalabarroconasilawadversebarnesibinaonbusyangcryptocurrency:hinihilingnilulondidpigitransitbulsaadditionallynaisubobeinteaddingeditorturonpanigbutterflyibabawkambingbanalestadosbihiramabigyanmatutongakmangmaidargueradyopagbabagong-anyonagpalalimmagkasinggandahinagud-hagodpagka-maktolnaninirahannagngangalangnakakatawaunibersidadbrindaragawproudibinubulongkapangyarihangmagpaniwalapanghabambuhaygayunmanpatutunguhanmakakatakassang-ayondagat-dagatanmatustusanexperts,pagkabuhaytagtuyotjobsdisenyongtoolnagsunuranglobalisasyonnagpatuloyikukumparamaipagmamalakingkapasyahanglobehouseholdspresence,pagsisisimakidalonakapasokstarteddivisoriapaggawaalignsmakikikainlilipadmaghihintayika-12masaktantumapostinungofranciscovaccinesfilmspaidpag-isipanyakapinkalabawuusapanpandidiribrancher,pagkabiglapaki-chargenananalongkitangherramientasaftermiyerkulesre-reviewpagbigyannaglaroyumuyukomagpahaba