Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "e-commerce,"

1. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

2. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

3. Lazada is an e-commerce platform that operates in Southeast Asia.

4. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

5. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

6. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

7. This has led to increased trade and commerce, as well as greater mobility for individuals

Random Sentences

1. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

2. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

3. He is not watching a movie tonight.

4. Sang-ayon ako na dapat natin pagtuunan ng pansin ang kalagayan ng ating kalikasan.

5. Napaangat ako ng tingin sa kanya saka tumango.

6. They ride their bikes in the park.

7. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

8. Bagai pungguk merindukan bulan.

9. Ang kamalayan sa kalagayan ng kalikasan ay nagtutulak sa atin na alagaan ito para sa susunod na henerasyon.

10. Nahulog ang saranggola sa puno ng mangga.

11. She helps her mother in the kitchen.

12. The clothing store has a variety of styles available, from casual to formal.

13. Sweetness can be a source of comfort and pleasure for many people.

14.

15. Nagpatawag ng pagpupulong ang guro sa silid-aralan upang pag-usapan ang mga plano para sa darating na taon.

16. Ang kanyang presensya sa aming pagtitipon ay lubos naming ikinagagalak.

17. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

18. The wedding ceremony is often followed by a honeymoon.

19. Ang malakas na pagkokak ng mga Palaka at paghuni ng mga Kuliglig ay sumaliw sa awit ng mga Maya.

20. Pumunta sila sa Zamboanga noong nakaraang taon.

21. Where there's smoke, there's fire.

22. The project was behind schedule, and therefore extra resources were allocated.

23. Hindi sila makaangal sa di makatarungang pagpapautang.

24. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

25. Sa isang tindahan sa may Baclaran.

26. Sa kasal, ang mga dalagang kasama ng bride ay nagdadala ng mga bulaklak at kumakanta.

27. El agua es esencial para la vida en la Tierra.

28. Pupunta si Trina sa Baguio sa Oktubre.

29. Many religious traditions believe that God is all-knowing, all-powerful, and benevolent.

30. Membuka tabir untuk umum.

31. Ang ibon ay mabilis na lumipad palayo matapos itong pakawalan mula sa hawla.

32. Napakagandang dalaga, wika niya sa sarili at tuloy-tuloy na nilapitan niya ito.

33.

34. Binigyan ng pangalan ng Apolinario Mabini ang isang bayan sa Batangas.

35. Ang carbon dioxide ay inilalabas ng mga tao.

36. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

37. Ang pagiging malilimutin ni Tina ay minsang nagiging dahilan ng kanyang pagkahuli.

38. Natakot ang pusa sa tunog ng paputok kaya't kumaripas ito papasok sa bahay.

39. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

40. Le sommeil est également essentiel pour maintenir une bonne santé mentale et physique.

41. Det er vigtigt at huske heltenes bedrifter og lære af dem.

42. Children's safety scissors have rounded tips to prevent accidental injuries.

43. Para cosechar las almendras, primero se deben sacudir los árboles con cuidado.

44. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

45. Ang mga buto ng mais ay dapat na itinanim sa loob ng 1-2 pulgada sa lupa, at dapat na itinanim sa isang distansya ng mga 8-12 pulgada sa pagitan ng bawat halaman

46. Binili ko ang bulaklak para kay Ida.

47. Kinuha naman nya yung isang bote dun sa lamesa kaso.

48. Når vi arbejder hen imod vores drømme, kan det føles som om alt er muligt.

49. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

50. Tesla's Autopilot feature offers advanced driver-assistance capabilities, including automated steering, accelerating, and braking.

Recent Searches

e-commerce,pinakawalannamilipitmagasawangkarapatantools,mainitpahahanapisafiapublishedsisterkararatingmatutongsupremediseasekamandagwaysiyonageenglishartificialstudentsrolledataquescommunicationinuminteknologinakatapatnakatalungkokapamilyanawalangnabubuhaynakakabangonpamburahumalakhaknagmungkahiunahineskuwelaerlindanamulaklaktravelermalambotpagkatakotmedikalmakakibonandayamatagpuaniloilounattendedtaga-nayonpagtulangbakuraninuulceradgangsabihindisfrutarpagsahodmagbalikcontinuesmayberegningerlumutangtungkodisinuotnakatitigpagbabantanapiliregulering,nakainompabulongpakakasalanmanonoodcommercialpayapangpatawarinnagwikangbinentahanilagaysurroundingsquarantineaguanovemberplanning,makabilimasipagkasoyparurusahanhoteltamiskunwarestawranboholmayabangnapatinginangkanpersondikyamdisseumiinomtillarguenunosumakaytignanpepesuccessfulinaitinagoneamapaibabawlendingmaginglasingeroprimerspentbranchlingidelvismerchandise18thlabaspersonalrosepasyarestawanmenuclassmateeasyincreaseddinalalikelydoingusingyeahcallingprovidedtelevisedkelanbakithomestinapaydalawamagitingsumalakaymagigitingditonakalagayisinulatnapapasayabroadcastmakasilongklaseopdeltmagtakanaglalabamalamansukatinpostcardmaayoshighestnabuhayshopping1970stransmitidasramdampangalanangiyeraglobalferrernapatakbotechnologicalnagbabalaclassroomnagbababakinabukasannakarinigtaga-suportaabangananubosestungkolsupplytumahantinatanongpansamantalamuchexperts,cesarkilakaibigancompostelakomunidadmagsi-skiingnakaririmarimisulatkatawanghinawakanmakitanagdabog