Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "juice"

1. Meron ho ba kayong mainit na kalamansi juice?

2. Puwede siyang uminom ng juice.

3. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

Random Sentences

1. Ang hirap pigilan ng inis kapag may nagawa sa atin ng hindi maganda.

2. Banyak pemilik kucing di Indonesia juga menjaga kebersihan kandang atau tempat tinggal kucing mereka.

3. Nabigkas ni Tarcila ang mahiwagang kataga bago nalagutan ng hininga sina Lala, Dada at Sasa kaya sa isang kisapmata ang tatlong dalaga ay naging ISDA!

4. One of the most significant areas of technological advancement in recent years has been in the field of communications

5. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

6. Despite the many advancements in television technology, there are also concerns about the effects of television on society

7. Sa aking balkonahe, ako ay nagtatanim ng mga maliit na halaman upang magkaroon ng kahit konting berdeng espasyo.

8. Nakikita si Carlos Yulo bilang inspirasyon ng maraming kabataang Filipino.

9. The act of forgiveness requires empathy and understanding, allowing us to see beyond someone's mistakes and recognize their humanity.

10. Ang abilidad sa pangangalaga ng kalusugan ay mahalaga upang mapanatili ang malusog na pamumuhay.

11. Pumunta kami sa Cebu noong Sabado.

12. Ano ang pangalan ng hotel ni Mr. Cruz?

13. Nauntog si Jerome sa kanilang pintuan.

14. Eine gute Gewissensentscheidung kann uns helfen, unser Leben in eine positive Richtung zu lenken.

15. Hindi na natapos ang aming hiking dahil sa biglang pagdidilim ng kalangitan.

16. Itim ang gusto niyang kulay.

17. The athlete completed a series of intense workouts to prepare for the competition.

18. In the land of Narnia, four siblings named Peter, Susan, Edmund, and Lucy discover a magical wardrobe.

19. Naaksidente si Juan sa Katipunan

20. Naghanda kami ng sorpresa para sa kanya.

21. Napuyat ako kakapanood ng netflix.

22. Wag ka na lang pumunta sa Palawan. aniya.

23. Unti-unti na siyang nanghihina.

24. Natutuwa ako sa pag-aalaga ng mga halaman kaya nahuhumaling ako sa pagtatanim.

25. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

26. At blive kvinde indebærer at tage ansvar for sit eget liv.

27. Un powerbank completamente cargado puede ser una fuente de energía de respaldo en caso de emergencia.

28. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

29. Umabot umano sa isang milyon ang mga dumalo sa pista ng bayan.

30. Di ka galit? malambing na sabi ko.

31. She watched a series of documentaries about the history of ancient civilizations.

32. Limiting the consumption of processed foods and added sugars can improve overall health.

33. The phone rang late at night, and therefore she was hesitant to answer it.

34. Tom Cruise is a highly successful actor known for his roles in movies like "Top Gun" and the "Mission: Impossible" series.

35. "Dogs leave paw prints on your heart."

36. I have a Beautiful British knight in shining skirt.

37. Bilang paglilinaw, ang proyekto ay hindi kanselado kundi ipinagpaliban lamang.

38. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

39. He has been writing a novel for six months.

40. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

41. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

42. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

43. Naniniwala ka ba sa legend ng academy?

44. Ang laki nang mga gusali sa maynila!

45. Scissors can be sharpened using a sharpening stone or taken to a professional for sharpening.

46. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

47. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

48. Seguir nuestra conciencia puede requerir coraje y valentía.

49. Samahan mo muna ako kahit saglit.

50. Las plantas ornamentales se cultivan por su belleza y se utilizan para decorar jardines y espacios interiores.

Recent Searches

sciencenakaangatmaipapautangjuicebosespayongpahiramalas-diyesbopolsalimentobipolarnalugodpwestopootsabadomamarilfacilitatingumingitasahandollarneed,broadisinamanakapapasongomfattendetokyonitongkararatingmagagamittruesandaliisasamamaitimreorganizingeeeehhhhtenderorderritwalpaksasikipsumusunonapatinginnakaririmarimsummernagpabayadinagawcrosskambingdali-dalingbestfriendflaviomalumbayloansaffectkumainnagpuntalibongredigeringnagsilapitinvolvenaglabanankare-karehugisbayanpaskopagkakamalikriskatainganagkalapitsumagotkisapmatadaladalafistschavitkasinggandaipapahingaayudaputingcomputeremagsalitabranchesreturnedginawarantakotproblemalumikhacompositoressagotkumukulobehaviorlenguajestatescalesafesambitaccederbitiwanbinilingmulighederumaboglulusogmatuklasanbalinganbinanggakamalianrelievedbanalcreatingbahagingreleasedspellingnasiramagpagalingpinilikissobservation,natutuwanapapatinginisinaboybahagicurtainschecksunconventionalnaglalaroo-ordermagdafascinatingumiwasfiancefriendsinopaketequezondatingpatinghigupinnapatingalanakikitangshopeepalapititakpalabasdelegatedmakatulognagtutulunganromerogamespasyenteschedulebataahitnagkatinginannakatingalawaiterperootrasnananaghiliatingmagpa-ospitalmaatimkirott-shirtvedbathalayumaonaghuhumindigchangeumarawsumasayawkaninagumuhitipinadalatubigmanilaexhaustedlibreobstacleslabinsiyamrisktransmitsnagmadalinganak-pawismakakasaktannahantadinfluentialnaaksidentelalargapatunayanrecibirnapatawagnagtataastiyaknakukuhanapakamisteryosohotelfreelancertradisyonnakikiabagsak