Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "then"

1. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

2. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

3. He missed his flight and then his luggage got lost. That just added insult to injury.

4. He was already feeling embarrassed, and then his friends started laughing at him. That added insult to injury.

5. He was already feeling sad, and then his pet passed away. That really added insult to injury.

6. I forgot my phone at home and then it started raining. That just added insult to injury.

7. She burned the dinner and then the smoke alarm went off. That just added insult to injury.

8. She lost her job, and then her boyfriend broke up with her. That really added insult to injury.

9. She was already feeling overwhelmed, and then she received a massive bill in the mail. That added insult to injury.

10. The beaten eggs are then poured into a heated and greased pan.

11. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

12. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

13. Then the traveler in the dark

14. Then you show your little light

Random Sentences

1. Natural language processing is a field of AI that focuses on enabling machines to understand and interpret human language.

2. Hinding-hindi napo siya uulit.

3. Maramot siya sa pagkain kaya hindi niya binibigyan ang kanyang mga kapatid.

4. Has she read the book already?

5. Salamat sa iyo kaibigan, nailigtas mo ako sa kamay ng itim na salamangkera.

6. Madalas na mayroong agam-agam sa mga relasyon at pag-ibig ng mga tao.

7. The awards ceremony honored individuals for their charitable contributions to society.

8. One of the most significant areas of technological advancement in recent years has been in the field of communications

9. Nang matuklasan ng binatilyong apo na siya ay isang pangit na hayop na, kumarimot siya patakas sa baranggay.

10. Paglalayag sa malawak na dagat,

11. Las escuelas ofrecen actividades extracurriculares, como deportes y clubes estudiantiles.

12. Sorry, I didn't catch your name. May I know it again?

13. Napansin ni Mang Kandoy na ang dugo ng diwata ay puti.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Los héroes pueden ser encontrados en diferentes campos, como el deporte, la ciencia, el arte o el servicio público.

16. The police were trying to determine the culprit behind the burglary.

17. Mabait siya at nanggagamot siya nang libre.

18. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

19. Ibinigay ni Ana ang susi kay Sally.

20. Butterfly, baby, well you got it all

21. Übung macht den Meister.

22. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

23. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

24. May konsyerto sa plasa mamayang gabi.

25. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

26. A lot of traffic on the highway delayed our trip.

27. La comida que preparó el chef fue una experiencia sublime para los sentidos.

28. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

29. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

30. Binalita ng magkasintahan ang kanilang kasal at ang nakatakdang araw ng pamamamanhikan.

31. Sa aming bakuran, nagtatanim kami ng mga tanim na pampalasa tulad ng luya at sibuyas.

32. Ibibigay kita sa pulis.

33. Siguro matutuwa na kayo niyan.

34. Las escuelas también pueden tener una biblioteca y recursos educativos en línea para los estudiantes.

35. Arbejdsgivere tilbyder ofte sociale fordele som sygesikring og betalt ferie.

36. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

37. Mahirap mahalin ang isang taong mailap at hindi nagpapakita ng tunay na damdamin.

38. Hinanap ko ang pulotgata sa bukid upang magkaroon ng panghimagas.

39. Les enseignants ont un impact majeur sur la vie des élèves et leur réussite scolaire.

40. Nakasuot siya ng itim na pantalon.

41. Ito ang tanging paraan para mayakap ka

42. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

43. Hindi dapat magbase ng pagpili ng mga kaibigan sa kanilang kababawan, kundi sa kanilang pagkatao.

44. Pwede bang sumigaw?

45. They have been studying science for months.

46. Pumitas siya ng isang bunga at binuksan iyon.

47. I am exercising at the gym.

48. Mi novia y yo celebramos el Día de los Enamorados con una tarde de películas románticas en casa.

49. Ang poot ay sumisindi sa aking puso sa tuwing naalala ko ang mga pagkakataon na ako'y iniwan at sinaktan.

50. Ang aming angkan ay nagpapahalaga sa tradisyong pamilya.

Similar Words

Athena

Recent Searches

murang-murathenmagawawikatalentnaguguluhangipapainitkasakitproporcionarleksiyonmaritespalipat-lipatnakatagopnilitbumilinakakapagodnapakahabaideyaalbularyoerankanilamarangyangpatidisyembrelivenalalaglagcomekapeplasafacepalaygustongwaysmagpasalamatchoiibinaonisinaboymataashoneymoonbulsasinisigymsinipangdi-kawasarelativelycommunicationsnapadaannagagandahangranbarnes1929misyunerongpinamalaginagreplykakahuyanmasasarapcandidatemenosnakakunot-noongmaninyofrieheikinuhabornmatandang-matandasanaygagamitinpinggaharaptradeneverituturotakesalakumiinitadoptedpinunitmagbalikagaipatuloynatingnagbiyahepierhinigitnakakagalamahiwagangdatungtomorroworugakwebangpaghingikumikilosconditioningnakabiladnagpakilaladulamulinooumaliskaarawantillcharitablemapapatoodependsequelaganapmakawalacontestwritemakabaliklumilipadcryptocurrency:alexanderfresconapapatungopositibofollowing,clasesnakatuklawnailigtastennisairporttaxiculturasmateryalesmaayosngunittinahaktarangkahantinanggaldaanghumakbanglegislationtaga-ochandobihasaaminganayatanagpagawakabighaawitannegrosbluesallergyligaligasahannalalabingmahabolhallrisemaluwagpag-aapuhapnag-iisipspecializedownbetweenmagsabinitongpangakoh-hoypulang-pulahampaslupaeuphoricnagsilapitamendmentsnayonsapatostumatawatumawa1960schambersdigitalmakapalagmagalitanimoyresignationnakaririmarimgulangdiwatamandirigmangprutasmatipunotumaliwashiningicapitalistkongresoabrilinihandaiyamottapatnangingitiandurantepaglakimamanhikancorporationpananglawnapatawagmerlinda