Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "king"

1. A king is a male monarch who rules a kingdom or a sovereign state.

2. Black Panther is the king of Wakanda and possesses enhanced strength, agility, and a suit made of vibranium.

3. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

4. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

5. Makinig ka sa 'king payo pagkat musmos ka lamang.

6. Mawala ka sa 'king piling.

7. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

8. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

9. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

10. The king's court is the official gathering place for his advisors and high-ranking officials.

11. The king's family and heirs are often closely watched by the public and the media.

12. The king's legacy may be celebrated through statues, monuments, or other memorials.

13. The king's portrait appears on currency and postage stamps in many countries.

14. The king's reign may be remembered for significant events or accomplishments, such as building projects, military victories, or cultural achievements.

15. The king's role is often ceremonial, but he may also have significant political power in some countries.

16. The king's role is to represent his country and people, and to provide leadership and guidance.

17. The king's royal palace is his residence and often serves as the seat of government.

18. The king's subjects are the people who live in his kingdom and are under his rule.

19. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

20. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

21. The title of king is often inherited through a royal family line.

Random Sentences

1. Nagdesisyon umano ang alkalde na ipagpaliban ang klase dahil sa masamang panahon.

2. La realidad puede ser sorprendente y hermosa al mismo tiempo.

3. Sa paligid ng bundok, naglipana ang mga ibon na nagpapaganda sa tanawin.

4. Mahilig si Tatay manood ng laro kung saan ang gamit ay bola.

5. It takes one to know one

6. Sa hirap ng sitwasyon, nangahas siyang humingi ng tulong mula sa mga estranghero.

7. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

8. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

9. Ihahatid ako ng van sa airport.

10. Nagpipiknik ang pamilya namin kung maaraw.

11. Gawa/Yari ang Tshirt sa Tsina.

12. You may now kiss the bride. Sabi nung priest.

13. La labradora de mi colega es muy sociable y siempre se lleva bien con otros perros.

14. Kinakailangan niyang magpakatatag kahit na nag-iisa siya sa laban.

15. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

16. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

17. Napansin ni Mang Kandoy na ang dugo ng diwata ay puti.

18. Naroon sa tindahan si Ogor.

19. Madalas na naglulusak sa dumi ang mga bakuran.

20. Oo naman! Idol ko si spongebob eh.

21. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

22. Eh ano ba talaga problema sa bagong maid mo?

23. La guerra contra las drogas ha sido un tema polémico durante décadas.

24. Nakangiting tumango ako sa kanya.

25. I accidentally spilled the beans about the surprise trip, but she was still excited.

26. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

27. Ang Ibong Adarna ay nagpapakita ng mahalagang papel ng musika at pag-awit sa kwento nito.

28. Up above the world so high,

29. Las escuelas pueden ser administradas por el gobierno local, estatal o federal.

30.

31. Nasaan ang Katedral ng Maynila?

32. Hindi dapat matakot sa mailap na mga pagsubok dahil ito ay makakapagbigay ng magandang aral.

33. Da Vinci tenía una gran curiosidad por la naturaleza y la ciencia.

34. Ilan ang tao sa silid-aralan?

35. Dalawampu't walong taong gulang si Paula.

36. ¡Hola! ¿Cómo estás?

37. The victim was able to identify the culprit who had been harassing them for months.

38. Ang rebolusyon ay bunga ng pagkamulat ng mga Pilipino kontra kastila.

39. Bestida ang gusto kong bilhin.

40. Bihira na siyang ngumiti.

41. Kahit mayroon akong mga agam-agam, hindi ko ito dapat ikumpara sa iba dahil may kanya-kanyang paghihirap ang bawat isa.

42. All is fair in love and war.

43. Ang pagkain ng masusustansyang pagkain at pag-aalaga sa aking katawan ay isang nakagagamot na paraan upang mapanatili ang aking kalusugan.

44. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

45. Les neuroscientifiques étudient le fonctionnement du cerveau et du système nerveux.

46. The culprit behind the vandalism was eventually caught and held accountable for their actions.

47. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

48. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

49. Nagkakamali tayo sapagkat tayo ay tao lamang.

50. He developed the theory of relativity, which revolutionized our understanding of space, time, and gravity.

Similar Words

malakingpinapakingganlalakingkalakingparkingakingworkingpinakingganLakingmakingnapakalakingmaipagmamalakinghikingkingdompinalakingLumakingangkingsmoking

Recent Searches

cigarettekingnakahantadtvspaghusayanoftepinanoodnicokanikanilanghinamaknagawangpapaanopartnermasasayasinabagkussaritastobabeemocionesiiwasanmakikipaglarobalanceskapekahaponnakakarinigfencingapatnapupaghabamarsonapansinnagbentabutihingcolorperomananaigbubongutak-biyanagwagimonetizingsolidifylumalakirevolutionizedpulang-pulanapabayaantalentpahabolmensahemedya-agwamadaliperfectayokoinakyatadecuado1787matumalkumainnagbababanagkalapitpinagmamasdannakakatakothumampasguideactionentry:nyanballbabasahinkinaintagtuyotkamalayanbritishmamarilalas-diyesdooncarloheartbeatuugud-ugodonlypinaghatidannalalamankassingulanggamitinsakimfremtidigeumikotlatestalinnagtuturokamakailanbagsaknaiiritangindividualnagsagawasurroundingsmaramotmakatarungangsikatbinanggatinaasanmadalingnanunuridaanjocelyntatlokombinationfriendcenteriniresetahinawakanmatapobrengpakakasalanbangkopabalangnakaririmarimpinalambotsumusunonaglokohansambitlaganapiosbulaklakdiinvivasharmaineiatfplaguedmagbibigaynapaiyakkatipunantelephonepangalananresortlumindolitinulosinalalayanbutiiikutanmusiciansmissionasinnangangahoypabilipamanpeksmanngumitihabitkuwadernosponsorships,nanlilisiknanamanconvey,suwailmiyerkulesbulakalaknakatagoanoiniindaisinaboykaramihanexpeditedexigentegalitmaglabapulonginaaminsinehanpinaggagagawasapatosanimoslavedissemakikinigumigtadtiniklingpalamutimakakasahodiniangatculpritnagmadalingunosgagamitgraphicprogresstsonggovelfungerendesegundoburdenpinakidalaunodamdaminnagtatakboescuelaskuwartokaninongbagyongmaya-mayat-shirthumalakhakengland