Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "king"

1. A king is a male monarch who rules a kingdom or a sovereign state.

2. Black Panther is the king of Wakanda and possesses enhanced strength, agility, and a suit made of vibranium.

3. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

4. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

5. Makinig ka sa 'king payo pagkat musmos ka lamang.

6. Mawala ka sa 'king piling.

7. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

8. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

9. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

10. The king's court is the official gathering place for his advisors and high-ranking officials.

11. The king's family and heirs are often closely watched by the public and the media.

12. The king's legacy may be celebrated through statues, monuments, or other memorials.

13. The king's portrait appears on currency and postage stamps in many countries.

14. The king's reign may be remembered for significant events or accomplishments, such as building projects, military victories, or cultural achievements.

15. The king's role is often ceremonial, but he may also have significant political power in some countries.

16. The king's role is to represent his country and people, and to provide leadership and guidance.

17. The king's royal palace is his residence and often serves as the seat of government.

18. The king's subjects are the people who live in his kingdom and are under his rule.

19. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

20. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

21. The title of king is often inherited through a royal family line.

Random Sentences

1. Las plantas de interior son populares para decorar espacios dentro de las casas u oficinas.

2. Pakibigay sa akin ang listahan ng mga kailangan nating bilhin sa palengke.

3. But television combined visual images with sound.

4. Medarbejdere kan blive tvunget til at arbejde hjemmefra på grund af COVID-19-pandemien.

5. Mga guro sina G. Santos at Gng. Cruz.

6. The momentum of the car increased as it went downhill.

7. Ang aking kabiyak ay ang aking pinakamatalik na kaibigan at tagapagtanggol.

8. Owning a pet can provide companionship and improve mental health.

9. Napaangat ako ng tingin sa kanya saka tumango.

10. Kumusta ang nilagang baka mo?

11. Hindi pa rin makapagsalita si Mang Kandoy.

12. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

13. Mahalaga sa akin na mapaligaya ang aking nililigawan kahit sa maliliit na bagay lamang.

14. The team's performance was absolutely outstanding.

15. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

16. No te preocupes, estaré bien, cuídate mucho y disfruta de tus vacaciones.

17. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

18. Tila may nais siyang ipahiwatig sa kanyang mga kilos.

19. Jacky. sabi ko habang inaabot ang kamay niya.

20. Television also allowed for the creation of a new form of entertainment, the television show

21. Me siento cansado/a. (I feel tired.)

22. Oy oy! Tama na yan baka maaksidente tayo!

23. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

24. Sepandai-pandainya tupai melompat, akhirnya jatuh juga.

25. Omelettes are a popular choice for those following a low-carb or high-protein diet.

26. The host introduced us to his wife, a beautiful lady with a charming personality.

27. Binilhan ko ng kurbata ang tatay ko.

28. Cooking at home with fresh ingredients is an easy way to eat more healthily.

29. However, investing also carries risk, as the value of investments can fluctuate and can result in losses.

30. Naglalaway siya sa bango ng kape na inilabas ng coffee shop.

31. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

32. Ang pakikinig sa malumanay na himig ng mga instrumento ay nagpapalapit sa akin sa isang matiwasay na mundo.

33. Hindi ko na kayang panindigan ang aking pagkatao dahil sa inis na nararamdaman ko.

34. Hinimas-himas niya yung likod ko pagkalapit niya saken.

35. Siya ay kilala sa kanyang abilidad sa pagsusulat ng mga makabuluhang tula.

36. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

37. Nagtatanong-tanong ako sa kanyang mga kaibigan upang malaman kung ano ang mga gusto at ayaw ng aking nililigawan.

38. Paki-translate ito sa English.

39. A couple of hours passed by as I got lost in a good book.

40. At ginawaran ng isang matamis na halik ang labi ng naguguluhang si Mariang Maganda.

41. The dedication of mentors and role models can positively influence and shape the lives of others.

42. Sana ay masilip.

43. Retweeting is a feature that allows users to share others' tweets with their own followers.

44. Nangyari ang aksidente sa daan kahapon kaya maraming sasakyan ang naabala.

45. Ow, sorry nagising ata kita. aniya.

46. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

47. Nangangaral na naman.

48. Marahil ay maulan bukas kaya't dapat magdala ng payong.

49. Nagtago kami sa lilim ng malaking bato habang naghihintay sa pagtatapos ng ulan.

50. Nagbigay siya ng magalang na pasasalamat sa tulong na ibinigay ng kanyang kaibigan.

Similar Words

malakingpinapakingganlalakingkalakingparkingakingworkingpinakingganLakingmakingnapakalakingmaipagmamalakinghikingkingdompinalakingLumakingangkingsmoking

Recent Searches

kingprogramsableremotethroughbetabasacontinuedactionsamahandumatingvirksomhedernaupomahihirapbalediktoryankaramihannagwalissuwailgrupobroadcastingpamanforstånaritobabestooplaysenergymagbubungadigitalnagbibigaywaterdagligemagsalitapagkakatayokawili-wilipagbebentacultivationtinungogospeltemperaturaamericalalabasmasyadongdistancianagpalutopagtiisanpanghabambuhaysaranggolaressourcernekagandahagkadalagahangnakapangasawaguidekinabubuhaykarunungancultivapagkahapopalabuy-laboypaglalaitnegosyantemakangitinasasakupannagtuturokomunidadnaiilaganmagkaharapnakatulognaibibigayinsektongbalitanaglakadsaritafollowing,tinangkathanksgivingnaghihiraplabinsiyamkaninumankomedorsasakyanseguridadhalu-halonaliwanaganinaaminhumahabatitamulti-billionilagayshiftnangingisaylalarganangangalogmaynilaisasamapakistangovernorssignalgawainbulalasnaiiritangwonderpakainincandidateslittlehinukaygustongunangkonsyertoejecutanmatutulogcarolsisterisinalaysaykargangofrecenmayabongasiaperwisyomaghintaybulonge-commerce,carmenmarmaingadvancerisegardenskyldesbigongpagputibinanggaalasanahinigitprutasleadingaumentarpriestsupilinpogisikosusulitmatapospaskongusamestultimatelypierhusographicmournediniinomtsekasingtigasspeciallatesttenderspeechesharingbriefmulighedvasquesngitipakainshowsseestorehariclasesagosanipetsacuentanelectionsflexibleprobablementemabaitkumakantainvolvecreationguiltysquatterpowersroquebabebehindupworkipinagbilingteamstringmakapilingprocessattacksolidifyulingwaitbinilingrefreturnedanothergaano