Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "nasan"

1. Nasan ka ba talaga?

Random Sentences

1. Frohe Weihnachten! - Merry Christmas!

2. Pinag-aaralan ng mga mag-aaral ang talambuhay ni Ramon Magsaysay bilang isang "Man of the Masses."

3. Ayaw ng nanay kong magtrabaho sa Linggo.

4. They have been playing board games all evening.

5. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

6. Tara! Sumama ka sa akin para makita mo kung gaano sila kaganda

7. Nagtatrabaho ako sa Manila Restaurant.

8. Abs yan!! Tingnan mo nga oh! May mga guhit guhit!

9. Ang ama, si Roque, ay mabait at mapagkalinga sa kanyang pamilya

10. I used a traffic app to find the fastest route and avoid congestion.

11.

12. She surprised me with a cake on my last day of work to bid me farewell.

13. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

14. Ang panitikan ay mahalagang bahagi ng kultura ng isang bansa.

15. Ailments are physical or mental health conditions that cause discomfort or illness.

16. Late ako kasi nasira ang kotse ko.

17. I love you, Athena. Sweet dreams.

18. You have to push yourself to the limit if you want to succeed - no pain, no gain.

19. Ano bang nangyari? tanong ni Lana.

20. She had been studying hard and therefore received an A on her exam.

21.

22. Maarte siya sa kanyang kagamitan kaya hindi siya nagpapahiram ng kanyang mga bagay.

23. Risk tolerance is an important factor to consider when deciding how to invest.

24. Naglalambing ang aking anak.

25. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

26. Les archéologues utilisent la science pour comprendre les cultures du passé.

27. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

28. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

29. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

30. Namatay ang mga pananim at ang tanging natira ay ang mga lasong puno na hitik na hitik sa bunga.

31. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

32. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

33. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

34. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

35. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

36. May bagong batas na ipinatupad ukol sa proteksyon ng mga manggagawa.

37. The patient's family history of leukemia increased their risk of developing the disease.

38. Ganyan talaga ang buhay lagi kang nasasabihan.

39. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

40. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

41. Butterfly, baby, well you got it all

42. Nagkaroon ng malubhang aksidente sa konstruksyon kung saan namatay ang ilang manggagawa.

43. Sa kabila ng pag-usbong ng modernong medisina, nananatili pa rin ang tiwala ng marami sa albularyo.

44. En invierno, los animales suelen hibernar para protegerse del clima frío.

45. Tesla's Gigafactories, such as the Gigafactory in Nevada, are massive production facilities dedicated to manufacturing electric vehicle components and batteries.

46. The value of stocks can rise or fall depending on a company's financial performance and market conditions.

47. Kings may wield absolute or constitutional power depending on their country's system of government.

48. Maglalaro nang maglalaro.

49. Tanghali na akong makauuwi nito, nausal niya habang binibilang sa mata ang mga nakapilang balde.

50. Malungkot ka ba na aalis na ako?

Similar Words

maranasannararanasan

Recent Searches

lilynasanjuankamustapangkatcarlomaulittresbinilhankagandabumoto1950slandmaskarakantowalngpangingimieducativasarbejdertransmitstaonisinalanglinaulammesangbossbilinplacebrindarabalapinagkiskisitakscientistprocesoipagamotpinalutoaayusinpakelammegetwalletpinunitinalalayandedication,perangeeeehhhhdayspagpapakalatcorrectinglumabas2001chefipapahingabulakingpaslitinspiredattackamazonstyrerpasinghalinteligentesmalakingginamitbansangmalakasdisciplinmagpahingaanak-pawisstaytungkodaniyapuwedenggovernorstrademasasayahalamangpalaisipanmahagwaytataymagtakatogethertsakacitizenisinuotsakitfilipinosocialespalagipagkamulatpagkalungkotknowsenduringapelyidotutoringlupapahahanapsighperadunhapag-kainanpinataygiftleftganunbusiness:nakadapaamparorobertlagiresignationgraphicsumayaganamalambingconsidereddistansyakinakitaanculturaenfermedades,kasaganaannagre-reviewmagbabakasyonsimbahankapatawaranedsanagmakaawamakikiraannangangahoysagotsabimaaksidentepangungusapnaiyakpaumanhininasikasosaritainferioresdekorasyonmagsusunuranpinapasayahuhsocietyvelfungerendealaalapasyentedyipnimaintindihanmaisusuotmakasalanangspellingtumamisnapuyatpananglawyouthskyldes,pagtatanimanumangfulfillmentnakitulogmalalakimagsisimulalaylaykainunconstitutionalnatitiranglumiittanyagbihirabilipinakamatunognatitirabalingankambingpesosmarinigparehaspelikulamatesabiyasgreatlyrumaragasangriyananihinthankginawatuvosumigawhugislaybraridumaanutilizarklasrumtshirtitutolnatandaanwashingtonhulyonapakaramingibonbasketbol