Type the word and use it in a sentence

Supported Language(s):
Danish
English
Spanish
Tagalog

2 sentences found for "marunong maglingkod"

1. Marunong nang maglinis at magtago ang mga taong marurumi.

2. Napatayo si Magda sa bangka, dahil alam niyang hindi marunong lumangoy ang dalawang bata.

Random Sentences

1. Sa kanya rin napapatingin ang matatanda.

2. Mas mainit sa Pilipinas kaysa dito.

3. Kanino humingi ng tulong ang mga tao?

4. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

5. Sa katagalan, natanggap na niya ang panunuksong ito.

6. Dahil sa pandidiri ay nilayuan niya ito pero ang pulubi ay humabol at nagmakaawa.

7. Ano pa ho ang kailangan kong gawin?

8. Anong oras gumigising si Cora?

9. Sa aling bahagi ng pelikula ka natawa?

10. Natawa si Aling Marta at pagkaraan ay dumukot sa bulsa ng kanyang bestido upang magbayad.

11. Maraming ideya na ibinibigay ang brainly.

12. Politics in America refers to the political system and processes that take place in the United States of America

13. Mabuti pa makatayo na at makapaghilamos na.

14. Hindi masikmura ni Manuel na ang binibigay na pera ng ilang pulitiko ay galing sa kasamaan.

15. Alam niyang maganda talaga ang dalaga at hindi totoo ang sinabi niya.

16. Datapwat mali sila ng akala, sapagkat ang anak ay hindi nagbago.

17. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

18. Ang nakita niya'y pangingimi.

19. Siya si Helena, nag-iisang anak siya nina Haring Bernardo at Reyna Lorena.

20. Kalimutan lang muna.

21. Hinde sa ayaw ko.. hinde ko lang kaya..

22. Hindi na niya makuhang laruin ang beyblade bagamat ayaw niya itong bitiwan sa loob ng kaniyang kamay o di kaya'y bulsa.

23. Kailangan ko ng bumalik sa aming kaharian dahil kung hindi ay hindi na tayo muling magkikita pa.

24. May klase ako sa Tagalog tuwing Lunes.

25. Tango lang ang sinagot ni Mica. Bumaling sa akin si Maico.

26. Pumasok ka na lang sa kwarto. Susunod na lang ako..

27. Matagal akong nag stay sa library.

28. Anong pagkain ang inorder mo?

29. In 1977, at the age of 42, Presley died of a heart attack

30. Bag ko ang kulay itim na bag.

31. Napakalaking ahas ang nakita ni Anjo.

32. Paano ka pumupunta sa opisina?

33. Tiyak na may isda kang mahuhuli! Sige, layas! Layas! pinagtulakan ni Kablan ang kaawa-awang matanda na napasubsob sa tarangkahan ng malaking bahay.

34. Nag-umpisa ang paligsahan.

35. Nagising si Rabona at takot na takot na niyakap ang kaniyang mga magulang.

36. Dadalawin ko ang aking mga alagang palaka sagot ng dalaga

37. Pakain na ako nang dumating ang kaibigan ko.

38. Papuntang Calamba ang dilaw na bus.

39. Lakad pagong ang prusisyon.

40. Nakatingin silang lahat sa amin, Sabay kayong maliligo?!?!

41. Ako ngayo'y lumilipad at nasa langit na.

42. Tumingin ako sa direksyon kung saan sya nagtatrabaho...

43. Nakakamangha naman ang mga tanawin sa lugar nyo Edwin.

44. Iiwan lang kita pag sinabi mong iwanan na kita..

45. Mayroon kaming bahay sa Tagaytay.

46. Nasa iyo ang kapasyahan.

47. Pagkasabi nya nun bigla syang ngumiti agad, Walang bawian.

48. Hinanap nito si Bereti noon din.

49. Tuluyan na siyang pumasok ng kwarto at isinara yung pinto.

50. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Recent Searches

maghaponkaalamanbutolahatnakukulilipinagtagposakopbulongpinakamatunognagpagawapagbibirotarangkahandialledtamaprovidefremstillefathernagagamitdinaluhannagdaosmagbakasyonmakikipagsayawnasasakupaninsektoparaanmag-ordernabuhaypagpapakilaladumilimlabahinpaglapastangannakasalubongnatapakanmakainpagdidilimhappypumapaligidkaraniwangnagdadasalnandyanathenanaglaonsariwatransport,nagpapaniwalamagdidiskostorenagpasyaipanghampasnamumuongnagkakasyanakapapasonglabitumawainiresetanakasusulasokvelfærdpasensiyatshirttoysnaguguluhangkanlurangulaymalabosumusunodmagbigaytunaypaitniyancocktailnaantignagliniscellphonegagandabilangguannoonkalaahhstopnakikiahumahagoknaalisnagwelgahalu-halonaiinisinirapankaloobanmagkakaroonnapakabagaltonomabaitnagtagisankaninumanitinaobbuwayanatabunansquatterryankasalukuyangsahodpakipuntahandinmayetotumagalpag-akyatkaagawiniisipnetolumuwastingnanemailkailangangputingsalbahenghelenaselvkørendenaglalabaklasengtinangkangimpentahimikmakauwimagsugalpisngiochandokikospaghettisino-sinogalakkinsenasisilawpinamalaginagsusulatasegúratengingisi-ngisingnamamsyalmamataannakasuotnakasunodnakarinignakapaligidnakapagsasakaynakapagsalitanakakatakotmarurusingnakakapagodnakakagalingnaka-smirknaiwangnai-dialpaghuhugasnaguguluhannagtuturosakupinnagplaynagpipiknikminsannagpatuloynaglalatangnaglahongnagkitanagkapilatmag-aralnagkalapitnagdiskopalengkenagbuntongnagawannagalitnagagandahannag-poutminutepalaginagtataaspaladpakikipagbabagpakialamilogpaki-ulitpaki-chargepakealamanpagtuturopagtatapospagtatanghalnapalingonpagraranassiguropagputimanpagongkaninopagnanasapagmasdanpaglisanpaglalaitpaglalabananpagkatapossaanpagkat