Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "no results"

1. Cutting corners in your exercise routine can lead to injuries or poor results.

2. Microscopes require careful handling and maintenance to ensure accurate results.

Random Sentences

1. The photographer captured a series of images depicting the changing seasons.

2. The company had to cut costs, and therefore several employees were let go.

3. Les préparatifs du mariage sont en cours.

4. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

5. Mga mangga ang binibili ni Juan.

6. Good morning, Beauty! aniya sabay halik sa mga labi ko.

7. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

8. The doctor measured his blood pressure and diagnosed him with high blood pressure.

9. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

10. Nagtatrabaho ako tuwing Martes.

11. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

12. Kailangan kong harapin ang aking mga agam-agam upang hindi ako magpakita ng kahinaan.

13. Sa pamamagitan ng bayanihan, nagkaroon kami ng pag-aayos ng mga kalsada sa aming lugar.

14. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

15. Ilan ang mga puno sa bakuran ninyo?

16. May bagong promotion ako sa trabaho kaya masayang-masaya ako ngayon.

17. Bagai pinang dibelah dua.

18. Ginaganap ang linggo ng wika ng Agosto.

19. Sampai jumpa nanti. - See you later.

20. Aray! nagcurve ball sya sa sakit sa sahig.

21. Pakidalhan mo ng prutas si Lola.

22. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

23. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

24. Women have diverse perspectives and voices that can enrich society and inform public policy.

25. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

26. Napakalaki talaga ng isla sa boracay.

27. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

28. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

29. Mi amigo del colegio se convirtió en un abogado exitoso.

30. Les enseignants peuvent utiliser des outils technologiques tels que les tableaux blancs interactifs et les ordinateurs portables pour améliorer l'expérience d'apprentissage des élèves.

31. Narealize ko sa dakong huli na mahal ko pa rin ang aking ex.

32. Alam ko pede kang mapagkatiwalaan, Peppy. Kaya please?

33. Ang pag-ikot ng mga isyu at pagkukubli ng mga katotohanan ay nagpapahiwatig ng pagiging bulag sa katotohanan.

34. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

35. Me gusta preparar infusiones de hierbas para relajarme.

36. Pinuri ni Pangulong Rodrigo Duterte si Carlos Yulo matapos ang kanyang tagumpay sa gymnastics.

37. Anong kulay ang gusto ni Elena?

38. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

39. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

40. Paano siya pumupunta sa klase?

41. She admires the bravery of activists who fight for social justice.

42. They have studied English for five years.

43. All these years, I have been working hard to achieve my dreams.

44. Kailangang pag-isipan natin ang programa.

45. Eksport af teknologi er en stigende del af den danske eksport.

46. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

47. Masayang kasayaw ng mga Kuneho ang mga Usa, ng mga Elepante ang mga Tamaraw, ng Zebra ang Tsonggo.

48. Nang makita ng manlalakbay ang mga nakasabit na bunga ay bigla niyang naalala ang kanyang gutom at pumitas ng mga ito.

49. Bilang paglilinaw, ang ating proyekto ay hindi pa tapos kaya hindi pa ito maaaring ipasa.

50. Hindi mo alam ang kanyang tunay na nais dahil hindi mo alam ang kanyang kaibuturan.

Recent Searches

nananaginipnakakagalingmusicianreserbasyonpaglalayagmakikiraantumawagtiniradorpagtiisannagpaiyaknagwelgakapangyarihannapakahusaymakakawawanagpipiknikvirksomhedermagkaibameriendaartistasfotospaghalakhaknaka-smirkpagngitinagkakasyamakikipagbabagkaloobangbloggers,simbahannakakagalapagkaimpaktopamamasyalmamanhikannaglalaronagmamadalimakahiramerhvervslivetnag-alalahitsuralumiwanagsasayawinsikre,sabadongnagpatuloyeskwelahannagsisigawnagandahanfilmnagawangpaghihingaloinilalabashinimas-himasnaglakadsasagutinsakristanmakidalonagpepekechangedinvestingminu-minutokumaliwasolarmensajestreatsnagpuyoskinakabahandadalawinsounddekorasyoninirapanmahahanaymakapagsabimamahalinpinakamahabatatlumpungtinangkakinauupuanpamahalaannakayukotekstlumusobsiniyasatbestfrienddahan-dahantaun-taonh-hoyngumingisinakuhanapanoodpagsisisipagkainismakukulaytinakasankinasisindakanapatnapuihahatidnagsmilekinalilibingandyanninanaispartshumalolikasmakawalakamandagsiksikaninventadocurtainsmasayang-masayapauwimakalingrenacentistadialledopisinataga-hiroshimamakaraanyakapguitarramangahasabundantemakabawipeksmanmanilbihandinipakikipaglabanlumabasinagawjingjingalas-doscountrymaglaroisusuotmasaholhudyatnanigaspinag-usapanhihigitmaligayanagwalisgarbansoskapatagangiraycurrentisinamanuevossabongcashnaiwangnag-aabangopportunitiesmatulunginmagdilimsirahidingtelabarnilalangsikipfiverrsocialemakulittibigheartbreakcubiclelayawinalagaanmarangyangscaleidamagkasinggandabumigaymagtipidhinigitmaghilamosprutasmagalingleadingpopularizeduondeterioratetelangkerbumingitshowsbinibinigisinggreenlegislativebinawiespadaoncepulabaleevilslaverawipinagbilingamingofficemagbubungacorrecting