Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

No sentences found for "områder,"

Random Sentences

1. Ang pagpapahalaga at suporta ng aking mga kaibigan ay nagpawi ng aking takot at pag-aalinlangan.

2. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

3. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

4. Kinapanayam siya ng reporter.

5.

6. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

7. At malaman ng maaga ang wasto sa kamalian.

8. It's not worth getting worked up over - it's just a storm in a teacup.

9. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

10. Magtanim ay di biro, maghapong nakayuko.

11. L'auto-évaluation régulière et la mise à jour de ses objectifs peuvent également aider à maintenir une motivation constante.

12. Pull yourself together and focus on the task at hand.

13. Emphasis can help clarify and reinforce the meaning of a message.

14. Su obra más famosa es la escultura del David en Florencia.

15. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

16. The film director produced a series of short films, experimenting with different styles and genres.

17. Sa dakong huli ng kanyang buhay, naging mapayapa na rin ang kanyang pagpanaw.

18. Ako na ang bahala dito. aniya at akmang tatayo na.

19. Ang pagmamahal at pag-aalaga ng aking kabiyak ay nagbibigay sa akin ng kasiyahan at kaligayahan.

20. The early bird catches the worm.

21. Nationalism is a political ideology that emphasizes the importance of the nation-state.

22. Malungkot ka ba na aalis na ako?

23. There were a lot of people at the concert last night.

24. Ang tagtuyot ay nagdulot ng krisis sa agrikultura sa buong rehiyon.

25. Ah ganun ba sabi ko habang naka tingin sa cellphone ko.

26. Nagluto ako ng adobo para kina Rita.

27. Lumiwanag ang lansangan dahil sa bagong ilaw trapiko.

28. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

29. Las personas que fuman tienen más probabilidades de sufrir de tos crónica.

30. Las plantas trepadoras, como las enredaderas, utilizan estructuras especiales para sujetarse y crecer en vertical.

31. Ang kulay ng langit sa takipsilim ay parang obra maestra.

32. Nasa labas ng bag ang telepono.

33.

34. Algunos animales hibernan durante el invierno para sobrevivir a las bajas temperaturas.

35. Sa karagatan ay masusumpungan ang magagandang koral at mga isda.

36. Elle adore les films d'horreur.

37. Les biologistes étudient la vie et les organismes vivants.

38. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

39. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

40. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

41. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

42. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

43. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

44. Gusto kong namnamin ang katahimikan ng bundok.

45. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

46. Nationalism can also lead to authoritarianism and repression of dissent.

47. Natandaan niya ang mga panunuksong iyon.

48. Magalang na hiniling niya ang tulong ng guro sa kanyang takdang aralin.

49. Ayaw mo ba? tanong niya sa malungkot na tono.

50. Nang magbabayad ako ng pinamili ko't kapain ko ang bulsa ko, e wala nang laman!

Recent Searches

paki-translatenapanangampanyamedya-agwaaktibistaimpornalagutannakahigangnakapaligidmadalasmagdaraosnangapatdantumikimlaruintumalondawkinalakihannami-missapatnapubayawaknakatindiglungsodbagoanimoytelevisiondevelopmentthumbssumalakaysisikatcrameinilabasnagdalatayolangkaymanilamariesakaynilapitanochandodahonbalinganbatok---kaylamigpatunayantinitirhanedsaibinalitangmagigitingnapapalibutanedadmariainiibigkahusayanangaleneroasinpshotrassumabogafterbaonokaylaryngitisneed,transmitidasbigoteramdamdiamondsinagotgreatbutihingejecutanpookpuladyanouehumanosdaychessgamespasangeasierhumiwapagkatfencingdumatingserparatingstudentalismonitorsimuleringertechnologicalpointrepresentedgenerationsuponprogramstutorialslutuindumaramihubad-baropanitikan,tilatusongpinisilna-curiousincitamenterdumagundongmahuhusaykagipitanumiinomlolamatalimmaongalakmakinangpaanodownpagbebentahahatoldoonditohojas,coatcashbusybaulbatipresyocarriessaringbangaralbaitbabaalin1990private1982young1876pagtatapos11pmyunwowunotaosoncomunesprovideddetectedremoterepresentativenyemitigateimpactednunnewkayabangantangeksleokaykanjobisahishimpag-asacirclebusawaatenakaramdamandnagpuyosagaabapumayagparusahanpaakyatpulgadadependingenglishmarangalhacerexperience,magtigilnaglabananmabutimembersbingiipaliwanagpalagiwhethernatingalaaccederbipolarenchantedcleankilo