Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "age"

1. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

2. Born in San Francisco in 1940, Lee was raised in Hong Kong and began training in martial arts at a young age

3. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

4. I finally finished my degree at age 40 - better late than never!

5. In 1977, at the age of 42, Presley died of a heart attack

6. Más sabe el diablo por viejo que por diablo. - Age and experience trump youth and cleverness.

7. The elderly man was happy sitting on his porch, watching the world go by - sometimes ignorance is bliss in old age.

8. The height of the basket and the court size varies depending on the age and skill level of the players.

9. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

10. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

11. The pneumonia vaccine is recommended for those over the age of 65.

12. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

Random Sentences

1. Jouer de manière responsable et contrôler ses habitudes de jeu est crucial pour éviter des conséquences graves.

2. Los powerbanks son populares entre los usuarios de teléfonos móviles y otros dispositivos electrónicos.

3. Mange mennesker bruger påskeferien til at besøge kirkegårde og mindes deres kære.

4. The objective of football is to score goals by kicking the ball into the opposing team's net.

5. pagkaraan ng kargang iyon ay uuwi na siya.

6. Itinapon nito agad ang nasabing bunga pagkatikim dahil sa sobrang asim.

7. Captain America is a super-soldier with enhanced strength and a shield made of vibranium.

8. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

9. Nagalit ang tigre at dali-dali nitong sinunggaban si Mang Kandoy.

10. La paciencia es necesaria para alcanzar nuestros sueños.

11. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

12. Uuwi kami sa Pilipinas sa Disyembre.

13. Oh di nga? Nasaang ospital daw?

14. Omelettes are a popular choice for those following a low-carb or high-protein diet.

15. Sa bawat tugtugin ng kundiman, nabibigyang-katarungan ang mga pinagdaanang sakit at luha ng mga taong nagmamahalan.

16. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

17. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

18. Maaaring magbago ang pulitika ng isang bansa dahil sa digmaan.

19. Hindi maganda ang pagmamalabis sa trabaho dahil maaaring magdulot ito ng pagkaburnout.

20. Magkahawak kamay silang namasyal sa gubat ng magagandang halaman na ang buwan at mga bituin ang tumatanglaw sa kanilang dinadaanan.

21. La deforestación es la pérdida de árboles y plantas en los bosques debido a la tala indiscriminada.

22. Nakakapagod din palang maging nag-iisa sa paglalakbay.

23. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

24. Nag-aalala ako sa mga pinagdadaanan ng aking nililigawan at lagi kong inuunawa ang kanyang mga kailangan.

25. Tiyakan ang kanyang pagkakapagsalita; ibig niyang sa pagkalito ng bata sa pag-aapuhap ng isasagot ay masukol niyang buung-buo.

26. Lumabas siya upang magmuni-muni sa oras ng takipsilim.

27. Pariwisata religi menjadi daya tarik bagi wisatawan lokal dan mancanegara yang tertarik untuk mengunjungi tempat-tempat suci dan melihat praktik keagamaan yang unik di Indonesia.

28. The backpack was so hefty, it felt like it weighed a ton.

29. Papaano ho kung hindi siya?

30.

31. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

32. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

33. Tinuro nya yung box ng happy meal.

34. Ang kamalayan sa mga isyu ng karapatang pantao ay nagpapabukas ng pinto sa pagtugon sa mga pangangailangan ng mga mahihirap.

35. Les patients hospitalisés doivent souvent rester alités pendant une période prolongée.

36. Sa panahon ng pandemya, maraming tao ang naging nag-iisa dahil sa lockdown.

37. Ang laki ng bahay nila Michael.

38. Naglalaro sa isip niya na ngayong napakalakas ng ulan lalo siyang magtataas ng presyo.

39. Nasa Diyos ang awa, nasa tao ang gawa.

40. Maingay ang bagong taon sa Pilipinas.

41. En helt kan være enhver, der har en positiv indflydelse på andre mennesker.

42. Bumibili si Rico ng pantalon sa mall.

43. Marami sa atin ang nababago ang pangarap sa buhay dahil sa mga karanasan.

44. She missed several days of work due to pneumonia and needed to rest at home.

45. I know they're offering free samples, but there's no such thing as a free lunch.

46. Dogs are often referred to as "man's best friend".

47. He is taking a photography class.

48. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang magbigay ng tulong at suporta sa ibang tao.

49. El nacimiento puede ser un momento de alegría y emoción para la familia, pero también puede ser estresante y desafiante.

50. The company used the acquired assets to upgrade its technology.

Similar Words

pageVillagemessagemakapagempakenageespadahannageenglishpageantmanagerimagesagesstageårsagerinteragererleveragediscouraged

Recent Searches

federallittlebecomingmalawakagetelebisyonnakayukodiplomaplankirotbilihinsikonakakainartistsrobinhoodspeedrevolucionadosinkbilaomukamakasilongtig-bebeintepagtiisanaplicacionesnaabotkongresochooseunangmaramotmalihishinigitmagtakapagkaimpaktoanitoetoinventiontumatanglawpitumpong2001criticskitanapakotungkolpagguhitboxmagsasakatamarawkumampieleksyonhmmmmmaghihintaymakikiligonanahimikagosphysicalfionangingisi-ngisingmarketing:nagpabayadmandukothayaangmalampasannasasabingespadaentermagpahabatanyagleosiguradosarongreservationna-curiousihahatidferrerpaamaitimmaistorbosincegapbalingbawianginoomanggamangyariritomalakitanghalipalayoknagpuntabluelumusobimaginationfalladatanagreplymakakawawamenuharingupworkcallmulighedersusunduinisamaeffectsbroadcastingnagdiretsoexitstringexplainiginitgitpapayagcontestpa-dayagonalso-calledlumabasipipilitproperlyevolvedlabanantooladditionallybabaingrepublicmagta-taxiressourcernepintuantaingapaulit-ulitmakalabasnagulathumabolngayongmagalitkaninlitsoncover,forståokaypakakatandaanlinggokatutubokinaumagahanmaaksidentemanagernagwaliskoreapinagtulakanmahiyaterminosenatemalagokahalumigmigantinulak-tulakmakatawanagmamaktolbandakikotiptulongtuwaculturesnagugutomalapaapibabawgirlfriendkararatingmariapasinghalnapatingalamessagemaingayhinihilingnapapahintonanlilisikpinauwionestudentstinulungananumankaarawanfilmsobra-maestraadvertising,producererbusiness,girlfollowing,healthieramparonakuhangsusulithinanakitestatetransportcnicojustpaligsahankatibayangopisinanakatitig