Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "allows"

1. Facebook allows users to send private messages, comment on posts, and engage in group discussions.

2. Facebook Events feature allows users to create, share, and RSVP to events.

3. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

4. Forgiveness allows us to let go of the pain and move forward with our lives.

5. Forgiveness is a gift we give ourselves, as it allows us to break free from the chains of resentment and anger.

6. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

7. Instagram is a popular social media platform that allows users to share photos and videos.

8. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

9. Lazada has a loyalty program called Lazada Wallet, which allows customers to earn cashback and discounts on purchases.

10. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

11. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

12. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

13. Retweeting is a feature that allows users to share others' tweets with their own followers.

14. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

15. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

16. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

17. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

18. The website has a chatbot feature that allows customers to get immediate assistance.

19. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

20. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

21. TikTok is a social media platform that allows users to create and share short-form videos.

22. Twitter allows users to send direct messages (DMs) to each other for private conversations.

23. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

2. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

3. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

4. Naging kaibigan ko muna ang aking nililigawan bago ko siya niligawan upang mas makilala ko siya nang husto.

5. Eh ano ba talaga problema sa bagong maid mo?

6. Sa mga tunog ng kundiman, nabibigyang-buhay ang mga kuwentong umiikot sa pag-ibig at pagdurusa.

7. Nagsimula na akong maghanap ng mga magagandang lugar upang dalhin ang aking nililigawan sa isang romantic date.

8. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

9. Menerima diri sendiri dan memiliki pemahaman yang mendalam tentang nilai-nilai dan keinginan kita sendiri juga membantu mencapai kebahagiaan.

10. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

11. Ang parusang angkop sa suwail na anak ay iginawad.

12. Sa kulturang Pilipino, ang punong-kahoy ay kinikilala bilang simbolo ng kalikasan at pagiging matatag.

13. Nakakamangha ang mga tanawin sa isla.

14. Nilagdaan niya ang kasunduan sa Biak-na-Bato noong 1897 para sa pansamantalang kapayapaan.

15. Ang hindi magmahal sa sariling wika, ay higit pa sa hayop at malansang isda.

16. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

17. Ilang araw ang reservation natin sa hotel?

18. Bago siya ipinatay, si Rizal ay isang aktibistang politikal na lumaban sa korupsiyon at pang-aabuso ng mga Espanyol sa Pilipinas.

19. Håbet om at finde kærlighed og lykke kan motivere os til at søge nye relationer.

20. Sa hatinggabi, maraming establisimyento ang nagsasarado na.

21. La esperanza es el combustible que nos impulsa a seguir adelante cuando todo parece perdido. (Hope is the fuel that drives us forward when all seems lost.)

22. Wala na ang beyblade at ang may-ari nito.

23. Taman Mini Indonesia Indah di Jakarta adalah tempat wisata yang menampilkan miniatur kebudayaan Indonesia dari 33 provinsi.

24. Eto isuot mo. binigay ko sa kanya yung dress na binili ko.

25. Disse virksomheder er ofte i førende positioner inden for deres respektive brancher, og de er med til at sikre, at Danmark har en høj grad af økonomisk vækst

26. Bata pa lamang ay kinakitaan ng ito ng husay sa larong chess.

27. Indonesia adalah negara dengan keragaman agama yang besar, termasuk Islam, Kristen, Hindu, Buddha, dan lain-lain.

28. Ang salarin ay kasalukuyang nakakulong sa bilangguan.

29. Salatin mo ang mga butones ng remote upang mahanap ang tamang pindutan.

30. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

31. Sinabi ng guro na huwag magtapon ng basura palayo sa tamang basurahan.

32. Les patients peuvent avoir besoin de soins palliatifs pendant leur hospitalisation.

33. Ano ang kulay ng paalis nang bus?

34. Akin na kamay mo.

35. Sa takip-silim, maaari kang mapakali at magpakalma matapos ang isang mahabang araw.

36. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

37. Nakikini-kinita niya ang paghugos ng mga mangingisda.

38. Sa anong tela yari ang pantalon?

39. The beaten eggs are then poured into a heated and greased pan.

40. Ang Mabini Bridge ay isang makasaysayang tulay sa Lipa City, Batangas.

41. The team lost their momentum after a player got injured.

42. Landet er en af de mest velstående i verden, og dette kan tilskrives en række faktorer, herunder en høj grad af økonomisk vækst, en velfungerende arbejdsstyrke og en høj grad af offentlig velfærd

43. Sa loob ng simbahan, nararamdaman ko ang isang matiwasay na kapayapaan.

44. The bridge was closed, and therefore we had to take a detour.

45. Dedication is the driving force behind artists who spend countless hours honing their craft.

46. May konsyerto sa plasa mamayang gabi.

47. Sebelum kelahiran, calon ibu sering mendapatkan perawatan khusus dari dukun bayi atau bidan.

48. Emphasis can help to ensure that a message is received and understood by the intended audience.

49. Emphasis is an important component of artistic expression, such as in poetry and music.

50. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

Recent Searches

umarawcircleconditionallowssimplengneverpaslitthroatwinsenerongamasarapnapakamisteryosokinamumuhianpresidentialnagpaalammerlindanakahiganglayuninmahinoghawlasiopao3hrsnatitirangmaestranahantadexperts,expeditedanonglunesmatayogmaisipgubatatensyonmaalwangamericanbandaphilosophicaldesarrollarsinakopkabuhayanlimitedresponsibleexisthardinsportspagka-maktolmakauuwigeologi,napaplastikannagawamabatongkommunikerermarketingtaosnapakabiliskondisyonbalediktoryanmakawalamanahimikumiisodsenadormanilbihanninanaisnalamandesisyonannananalohitsurapagkuwamanggagalingsong-writingnananaginipmagpalibrenagkakasyapapanhiktaga-nayonngingisi-ngisingkumakalansingnagulatsubalithanapinmalungkotinvestnamataymakatulogpresidentemaliwanagnakapasokpresence,makatatloleksiyonkinauupuansasagutinbefolkningen,napakasipagisasabadvaliosapinapakingganrewardingkabighakirbytuyoafternoontiyaknagbibigayanmahahawamanakbonakitulogpakakasalanminatamisanumangtradisyonvegasmartianlalimhuertoipinangangakengkantadapampagandafavorendviderekontraairplanesmaranasanmakatihinilamatutongtiniklinghetomalimithigupinmagsabiarteautomationpagputibuntismayamanghugisaksidentenetflixkamotenasuklamlihimothersnararapatpakisabipangakocredithumigamanuksonangdemocracyscottishsuottaasrevolutionizedtsakapatayshinesvetobangkomaibalikkahilinganbumigaynagtatanimmahigpitgayunpamanopisinanagdaramdamrabeiguhitdeterioratefurpopcornpalapitamodreamtradeiniwantoreteyepreachadangdragondamitbalekumarimotyoungtsaabatitools,vampiresdyantomarriskeventsdollyconectadoskayaform