Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

51 sentences found for "tubig ulqn"

1. Ang bawat gabi, ang aming katiwala ay nagiigib ng tubig mula sa poso upang punuin ang tangke ng bahay.

2. Ang linaw ng tubig sa dagat.

3. Ang mga bata ay natutong maging responsable sa pamamagitan ng pagsasagawa ng gawaing nagiigib ng tubig sa halamanan.

4. Ang mga mamamayan sa mga lugar na mayaman sa tubig-ulan ay dapat mag-ingat sa pagtatapon ng basura upang maiwasan ang pagbabara ng mga daluyan ng tubig.

5. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

6. Ang tubig ay kailangan ng tao para mabuhay.

7. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

8. Ang tubig-ulan ay isang mahalagang bahagi ng siklo ng tubig sa kalikasan.

9. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

10. Ang tubig-ulan ay maaaring magdulot ng kaguluhan sa mga lugar na hindi handa sa mga pagbabago sa panahon.

11. Ang tubig-ulan ay maaaring magdulot ng malinis na hangin sa pamamagitan ng pag-alis ng polusyon sa hangin.

12. Ang tubig-ulan ay maaaring magdulot ng mga masaganang pananim at halaman dahil sa pagtustos sa mga pangangailangan ng mga ito.

13. Ang tubig-ulan ay maaaring magdulot ng mga sakuna tulad ng baha, landslides, at iba pa.

14. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

15. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga katas ng lupa at kemikal, na maaaring magdulot ng polusyon sa mga ilog at lawa.

16. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga mapanganib na mikrobyo sa mga kalsada at iba pang mga lugar.

17. Ang tubig-ulan ay maaaring magdulot ng pagpapakalma at kapanatagan sa mga tao dahil sa tunog ng ulan at sariwang hangin.

18. Ang tubig-ulan ay mahalaga sa pagpapalago ng mga halaman at hayop.

19. Ang tubig-ulan ay mahalaga sa pagpapanatili ng kalikasan at pangkabuhayan ng mga tao, kaya't mahalaga na ingatan at pangalaga

20. Ang tubig-ulan ay nagbibigay ng kahalagahan sa mga pangangailangan ng mga tao, tulad ng pag-inom at pangangailangan sa pagsasaka.

21. Ang tubig-ulan ay nagbibigay ng mga oportunidad para sa mga aktibidad tulad ng paglalaro sa ulan, pagsusurfing, at iba pa.

22. Ang tubig-ulan ay nagbibigay ng natural na tubig sa mga lawa at ilog, na nagbibigay ng tahanan at pagkain sa mga isda.

23. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

24. Ang tubig-ulan ay tumutukoy sa ulan na mayaman sa tubig at mahabang tagal.

25. Bigla, mula sa tubig ay isang babae ang lumutang sa hangin.

26. Dahil sa matinding init, marami ang nagiigib ng tubig sa mga puno ng prutas upang hindi ito malanta.

27. Di natagalan, isinawak niya ang kamay sa nalalabing tubig sa balde.

28. Hindi malinis ang tubig na iyan, bumili ka ng iba.

29. Isinaboy niya ang tubig na nasa harap.

30. Itinaob niya ang kaunting nasahod na balde at ang tubig ay gumapang sa semento at umabog sa kanilang mga paa ni Ogor.

31. Kapag nagkakaroon ng sakuna, ang mga volunteer ay nagiigib ng tubig para sa mga apektadong pamilya.

32. Kasama ho ba ang koryente at tubig?

33. Mahina ang tulo ng tubig sa kanilang pook.

34. Malapit lamang pala ang pinaghatidan nito ng tubig.

35. Masyadong mababaw ang tubig sa tabing-dagat.

36. Nag-aabang ang mga kabataan sa kalsada habang nagiigib ng balde-balde ng tubig para sa kanilang water balloon fight.

37. Naging tradisyon sa aming barangay ang nagiigib ng tubig para sa binyag ng mga sanggol.

38. Napakainit ngayon kaya't kinailangan kong nagiigib ng malamig na tubig para sa sarili ko.

39. Narinig ko ang lagaslas ng tubig mula sa shower.

40. Nasa tabi ng ilog, pinagmamasdan niya ang mga isdang naglalaro sa tubig.

41. Ngunit lumakas ang agos ng ilog, at napailalim sa tubig ang mag-aama.

42. Papanhik din sana siya sa tuktok ng burol subalit naabot siya ng rumaragasang tubig-ulan na lalong nagpalalim sa dagat-dagatan.

43. Sa dapit-hapon, masarap tumambay sa beach at mag-enjoy sa tubig.

44. Sa kasawiang-palad ay tinamaan ang magkakapatid at agaw-buhay na bumagsak sa tubig.

45. Sa mga lugar na malapit sa ilog, ang mga punong-kahoy ay nakakatulong sa pagpapabuti ng kalidad ng tubig.

46. Sa tabing-dagat, natatanaw ko ang mga isda na lumilutang sa malinaw na tubig.

47. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

48. Siya ay nagiigib ng tubig sa banyo habang nag-aayos para sa trabaho.

49. Tumaba sila ng tumaba hanggang sa tuwing maliligo kahit na pa tatlong tao lang sa sapa ay umaapaw agad tubig.

50. Tuwid ang tindig nito at halos hindi yumuyuko kahit may pasang balde ng tubig; tila sino mang masasalubong sa daan ay kayang-kayang sagasaan.

51. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

Random Sentences

1. Las plantas suculentas son conocidas por su capacidad para almacenar agua en sus tejidos.

2. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

3. Sabi ng mga teologo, ang pag-aari ng simbahan ay nagbibigay kaligtasan sa mga kaluluwa mula sa purgatoryo.

4. Modern civilization is based upon the use of machines

5. Di ko rin alam kung ano na nga bang nangyayari.

6. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

7. The Niagara Falls are a breathtaking wonder shared by the United States and Canada.

8. Holy Week er en tid til eftertanke og refleksion over livets cyklus og død og genfødsel.

9. "Dogs leave paw prints on your heart."

10. She's always creating drama over nothing - it's just a storm in a teacup.

11. Sinuspinde ng pulisya ang operasyon sa paghuli ng salarin dahil sa kakulangan ng ebidensiya.

12. Natawa ako sa maraming eksena ng dula.

13. Hindi ko alam kung paano maaalis ang aking mga agam-agam sa aking kinabukasan.

14. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

15. Sinikap niyang kumbinsihin ang mga katutubo upang maging Katoliko.

16. Sa purgatoryo, inaalis ng Diyos ang mga natitirang kasalanan sa mga kaluluwa bago sila tanggapin sa Kanyang harapan.

17. Ang mahal pala ng iPhone, sobra!

18. Wala ho akong kinukuha sa inyong pitaka.

19. Ilalagay ko 'to sa mga action figure na collections ko.

20. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

21. Nagustuhan kita nang sobra, kaya sana pwede ba kita makilala?

22. May mga taong naniniwala na ang digmaan ay hindi ang solusyon sa mga suliranin ng mundo.

23. I'm not impressed with his art. Paintings like that are a dime a dozen.

24. Masayang-masayang napanood ng Buto ng Kasoy ang sayawan, kantahan, at pagkakatuwaan ng mga hayop at halaman.

25. She is not playing with her pet dog at the moment.

26. There are a lot of opportunities to learn and grow in life.

27. Ano ang kulay ng libro ng kaklase mo?

28. Dinig ng langit ang hiling ni Waldo upang ang paghihirap nila ay mabigyan ng wakas.

29. Baka puwedeng hiramin ko ang iyong mga gamit pang-kemikal para sa eksperimento.

30. May klase ako tuwing Lunes at Miyerkules.

31. Kahit nasa gitna ng kainan, siya ay tulala at parang may iniisip.

32. Nandito ako sa mall. Trip lang, ayoko pang umuwi eh.

33. Hawak ang tirador ay sinaliksik ni Kiko ang buong paligid.

34. Omelettes are a popular choice for those following a low-carb or high-protein diet.

35. Pakiramdam ko ngayon ay puno ng inis dahil sa ginawa mo.

36. Climate change is one of the most significant environmental challenges facing the world today.

37. It ain't over till the fat lady sings

38. The surface of the football field can vary, but it is typically made of grass or artificial turf.

39. Mula sa bintana ng mga barungbarong, nakikita niyang nagsusulputan ang ulo ng mga bata.

40. Ang malalakas na tama ng kidlat ay binulabog ang langit at nagdulot ng takot sa mga tao.

41. O-order na ako. sabi ko sa kanya.

42. The authorities were determined to find the culprit responsible for the environmental damage.

43. Las heridas pueden ser causadas por cortes, abrasiones o quemaduras.

44. Ang paggamit ng droga ay hindi lamang nanganganib sa iyong buhay, kundi pati na rin sa buhay ng mga mahal mo sa buhay.

45. La película que produjo el estudio fue un gran éxito internacional.

46. On dit souvent que l'argent ne fait pas le bonheur, mais il y contribue grandement.

47. Utak biya ang tawag sa mahina ang pag iisip

48. Really? What is he doing sa tapat ng room natin?

49. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

50. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

Recent Searches

unangb-bakitpamilihanfiverrmaynilanaghihinagpisitopamanpagtatakamanualtapatkauritig-bebentedi-kawasacultivapintuanBagyobulalaskapwauntimelymagisingagricultoresdespuessahodmatulismagandangmuranglabanitinanimculturalmangahasayongustotaossumayawnatutuwabulsaumisipmesangwidenangangahoySubalitpananakotpaglapastanganmababatidnamanghamapagbigayakalawaterpagkatbayarankomunidadpaligidkombinationnaglalarokaarawanpinyahintayinkamalayandetectedulamdekorasyonBatayipinailawobra-maestrakaninumanLalokuligliganiyamay-bahaynewhigantesilapayomagkanomalungkotpaskomaliwanagde-dekorasyonnasanilagaymulalikasbiyakpamilyabangkamahahanaynagdaosgayunpamannasaktanalongmagturonagbibigayanbusilakumaagostumayoTuyopaanokongsimulamaaamongtanganmasayahumabolna-curiousnakaraanpapelkinagagalakkikotagalabakumalatkaynakabawigumawasommasaholkinakailangangmahirapmayumingpancitadicionalesnuevostransportbawapinigilanninyonaunanapaluhareaderssamakatuwidpresentationmaghugasmismopagmasdanbagkusprogramasinampaltigilbulakalakSapagkatmanghulikailantradicionaltungkolpagkakamalikarapatangfestivalkuninapotinapayhinahanapkeepiglapkasamanglayunincontent,tsinelasambapumuntainhalengunitnamumuongkalikasannaglalakadthroughkonsyertonasagutansunud-sunuransagutincuandoPalibhasapaglalayagnahintakutannakapagtaposabalakundipoonnagsusulatperonararapatshouldpitocontinuelumilingonnagsalitaakinspecificnagbabasakayanahulogsinasadyahinilapagsubokmauliniganmatchingHabangdumatingMatatagKapag