Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "audience"

1. Emphasis can help to ensure that a message is received and understood by the intended audience.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

4. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

5. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

6. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

7. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

8. Sa mga nakalipas na taon, yumabong ang mga blog na mayroong malaking audience.

9. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

10. The singer's performance was so good that it left the audience feeling euphoric.

11. These films helped to introduce martial arts to a global audience and made Lee a household name

12. Think about what message you want to convey, who your target audience is, and what makes your book unique

13. TikTok has become a popular platform for influencers and content creators to build their audience.

14. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

15. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Kahit mayroon akong mga agam-agam, hindi ko ito dapat ikumpara sa iba dahil may kanya-kanyang paghihirap ang bawat isa.

2. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

3. Hihiramin ko sana ang iyong kopya ng libro para sa aking assignment.

4. Nag-iisa siya at tulala sa gitna ng kalsada nang makita ko siya kaninang umaga.

5. Ang kalayaan ay nagbibigay sa atin ng kakayahang magpasya at magplano para sa ating sariling kinabukasan.

6. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

7. Sino-sino ang mga nagsibili ng mga libro?

8. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

9. Es importante limpiar y desinfectar las heridas para prevenir infecciones.

10. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

11. Si Anna ay maganda.

12. Walang sinuman ang nangahas na kontrahin ang plano ng kanilang lider.

13. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

14. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

15. Menghargai dan mensyukuri apa yang kita miliki saat ini merupakan kunci untuk mencapai kebahagiaan.

16. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

17. Ang tubig-ulan ay nagbibigay ng natural na tubig sa mga lawa at ilog, na nagbibigay ng tahanan at pagkain sa mga isda.

18. Gusto ko sana na malaman mo na pwede ba kitang mahalin?

19. Ano ang pangalan ng doktor mo?

20. Les chimistes travaillent sur la composition et la structure de la matière.

21. Omelettes are a popular choice for those following a low-carb or high-protein diet.

22. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

23. Ang paglalakad sa kalikasan at pakikisalamuha sa kalikasan ay nakagagamot sa aking isip at katawan.

24. La pobreza puede ser un círculo vicioso que se transmite de generación en generación.

25. Tumayo ako tapos tumayo rin si Carlo.

26. El nacimiento de un hijo trae consigo responsabilidades y la necesidad de cuidado y protección.

27. Después de una semana de trabajo, estoy deseando que llegue el fin de semana.

28. Hindi dapat natin kalimutan ang ating mga pangarap kahit na may mga pagsubok sa ating buhay.

29. The professor delivered a series of lectures on the subject of neuroscience.

30. La letra de una canción puede tener un gran impacto en la audiencia.

31. En invierno, los días son más cortos y las noches son más largas.

32. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

33. Mangiyak-ngiyak siya.

34. La tos crónica dura más de ocho semanas y puede ser causada por una variedad de factores.

35. Napakalaking ahas ang nakita ni Anjo.

36. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

37. Samahan mo muna ako kahit saglit.

38. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

39. Emphasis can be used to highlight a person's strengths and abilities.

40.

41. Nakapunta ako sa Bohol at Cebu.

42. All is fair in love and war.

43. Some viruses, such as herpes and HIV, can remain in the body for life and cause chronic infections.

44. Nasan ka ba talaga?

45. Nagdala si Butch ng laruan para sa bata.

46. Hindi niya iningatan ang kanyang cellphone, samakatuwid, nasira ito agad.

47. She watched a series of documentaries about the history of ancient civilizations.

48. Halika, i-recharge natin ang baterya mo.

49. Ang tula na isinulat niya ay ukol kay Romeo na matalik niyang kaibigan.

50. Ang pagdarasal o meditasyon ay nakagagamot sa aking kalooban at nagbibigay ng kapayapaan.

Recent Searches

audiencepabalangflaviochoinaggalaiconhunihopeeffektivomgbarrocomerryadangnapatingalamadurassigahongtinangkaeducationhomehehestreaminghearbosstendersabihingmedievalanimoywestdulotdiamondhardgoshpinangalananggodtgoaljeromemapaikotrichcallermeetmuchasipagbililargergiveginageargawaganagrabeibabainformationvarioussumapitdumatingilanwealthgagaleftsamamaputifuryevenhimselfnaggingpinilingmobilefuelfrogfreefeltfauxfarmfamesalapiedit:fallmasteralignsrobertreleasedfakesanaymereerapoverviewellaegenedsaedaddyipdrewdontdoesngusodinidealdaysdatidaancruzmagsunogpinakamatunognaawaclubbihirangchefchadcarscarecakebutobowlbotomakuhabornpulisbiennatutulogbetabestbellbeenkasalukuyanbatobasabarobankballcommercebalebahabagoayanmovingawitawayasulasinasimasiapinakamatapatarghzoomaraypakukuluanyungarawpangalananyorkaralyariapoyyangapatworkanyowinsannawinepagamutananimpagtataaswifiandywideginamotanakamoyrelativelywalaalokviewallevetoalasveryalamusednagkalapitentrancepinaghatidanhinawakanpinakamalapithinimas-himasperwisyobinibiyayaanahasunosbukasagadulitabermakisigguhitpeacesamugabinglapitanlaryngitis