Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "audience"

1. Emphasis can help to ensure that a message is received and understood by the intended audience.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

4. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

5. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

6. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

7. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

8. Sa mga nakalipas na taon, yumabong ang mga blog na mayroong malaking audience.

9. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

10. The singer's performance was so good that it left the audience feeling euphoric.

11. These films helped to introduce martial arts to a global audience and made Lee a household name

12. Think about what message you want to convey, who your target audience is, and what makes your book unique

13. TikTok has become a popular platform for influencers and content creators to build their audience.

14. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

15. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

2. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

3. pagkaraan ng kargang iyon ay uuwi na siya.

4. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

5. Bilang paglilinaw, hindi mandatory ang pagsali sa aktibidad na ito.

6. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

7. Gusto mo ba ng mainit o malamig na kape?

8. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

9. She was already feeling overwhelmed, and then she received a massive bill in the mail. That added insult to injury.

10. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

11. Nagbabaga ang mga damdamin ng magkasintahan habang nag-aaway sila.

12. Emphasis can be used to provide clarity and direction in writing.

13. Bukod tanging ang buto ng kasoy ang lungkut na lungkot.

14. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

15. Malakas ang narinig niyang tawanan.

16. Hindi maiwasan ang naghihinagpis na damdamin ng mga biktima ng kalamidad.

17. Ang aming pagsasama bilang magkabilang kabiyak ay puno ng pagpapahalaga at respeto sa isa't isa.

18. Maraming bagong laruan sina Justin at Andre.

19. Gaano ko kadalas dapat inumin ang gamot?

20. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

21. Ang mga Pinoy ay kilala sa pagiging masayahin at matulungin.

22. Wag kang mag-alala.

23. Nationalism can inspire a sense of pride and patriotism in one's country.

24. Isang matandang lalaki naman ang tumikim sa bunga.

25. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

26. Tinanong ang kanyang ina kung nasaan ito.

27. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

28. Nahuhumaling ako sa pagbabasa ng mga self-help books dahil nagbibigay ito ng inspirasyon sa akin.

29. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

30. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

31. Les échanges commerciaux peuvent avoir un impact sur les taux de change.

32. Omelettes are a popular choice for those following a low-carb or high-protein diet.

33. Gracias por hacerme sonreír.

34. Hindi ito nasasaktan.

35. Les enseignants sont responsables de la gestion de classe pour garantir un environnement propice à l'apprentissage.

36. Football has produced many legendary players, such as Pele, Lionel Messi, and Cristiano Ronaldo.

37. Nasurpresa ako ng aking mga kaibigan sa aking kaarawan kaya masayang-masaya ako ngayon.

38. Ang Ibong Adarna ay patuloy na nakakaakit ng mga mambabasa sa ngayon dahil sa kanyang pagpapakita ng kagandahan ng kultura at panitikan ng Pilipinas.

39. Ano ang gustong sukatin ni Merlinda?

40. En el siglo XIX, el Romanticismo español tuvo un gran impacto en la música, con compositores como Isaac Albéniz y Manuel de Falla

41. Ang alin? iyamot na sabi ko habang nakapikit na.

42. I'm on a diet, but I couldn't resist having a small slice of cake.

43. Si Hidilyn Diaz ay tinawag na “Pambansang Bayani” sa larangan ng palakasan.

44. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

45. Ang mga mata niyang banlag ay animo'y laging gulat.

46. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

47. Sabi mo eh! Sige balik na ako dun.

48. A través de la música, las personas expresan sus emociones, comparten sus historias y conectan con los demás

49. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

50. Meal planning and preparation in advance can help maintain a healthy diet.

Recent Searches

pabalangaudienceplasaboholayokokelanmanuksobinasarenatopanindangbalangkapagsukatdeterioratearbejderbairdmayroonconsistandamingmedidareachipapaputoltapatsaferrailpayatmisamalinismeetpakpakthenrichbumahasoredalandannahulikwebangwidetuwidinfluentialoftedevicescandidateputaheadventyoungstudentatacommunicationilannag-iisaliigheftyplatformdedicationinfinityreadingbehalffencingcornerstatingnicefeedbackmaputikatabingdespuestrapikkayabateryataon-taonbalinganmundoatehitsuratanyagpokerklasesinasagotratedumatingemailmateryalesinangellensponsorships,inspirationikinakagalitspiritualnagliliyabnakaupomagpa-ospitalnagliliwanagpinakamaartengkinapanayampagkakalutomagkaparehokagandahagsalamangkeronangampanyaisinulatpinakamatabangpagpapakilalalumabaslalakeanak-pawistootatayotatlumpungmagpakasalnagpuyoskabundukannagmadalingnapapatungokinauupuangnakalipasnagpabayadlalakinaapektuhanpagtinginnaliwanaganlalakadkuwadernomagkaharaptravelbeautymovietanggalinkisapmatakinalilibinganpagkuwanganitomalulungkotnagkasakitpaciencianalalabinghimihiyawdisfrutarkidkirandiwatatumunogiikutanumangatdepartmentkumampihahahanakitulogsisikatbinuksantog,kumanankastilangnagkaroonninamangyaricualquiermagamotmagkasakitsiksikanmagsugallabinsiyampilipinasnapalitangumigtadkutsaritanghinukaydiligingasmencaracterizanaantigkonsyertoconvey,paraangtusongriegamagka-babytomorrowtangandiaperbooksmatipunopagkatyorksakaylabahinalagamaubosinaapikabosesmaarikantodapatlarodipanglandbritishanitolalasentenceklasengiskedyul