Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "audience"

1. Emphasis can help to ensure that a message is received and understood by the intended audience.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

4. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

5. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

6. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

7. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

8. Sa mga nakalipas na taon, yumabong ang mga blog na mayroong malaking audience.

9. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

10. The singer's performance was so good that it left the audience feeling euphoric.

11. These films helped to introduce martial arts to a global audience and made Lee a household name

12. Think about what message you want to convey, who your target audience is, and what makes your book unique

13. TikTok has become a popular platform for influencers and content creators to build their audience.

14. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

15. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Sumasakay ako ng taksi sa umaga araw-araw.

2. Kailangang salatin mo ang tela para malaman kung gaano ito kalambot.

3. En invierno, los deportes en el hielo como el hockey sobre hielo y la patinaje sobre hielo son muy populares.

4. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

5. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

6. When the blazing sun is gone

7. Ang ganda ng bagong laptop ni Maria.

8. Nakita ng mga ibon si Paniki at tinanong siya kung bakit siya asa kanilang kampo samantalang isa naman daw siyang mabangis na hayop.

9. Nakangisi at nanunukso na naman.

10. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

11. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

12. Los padres pueden elegir compartir el momento del nacimiento con familiares y amigos cercanos, o mantenerlo privado y personal.

13. Sumapit ang isang matinding tagtuyot sa lugar.

14. Umuuwi siya sa probinsiya linggo-linggo.

15. Durante las vacaciones, nos reunimos alrededor de la mesa para compartir historias y risas con la familia.

16. Ang nagtutulungan, nagtatagumpay.

17. Kulay pula ang libro ni Juan.

18. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

19. "Kung walang tiyaga, walang nilaga" ay isang bukambibig na nagpapahayag ng katotohanan na ang kakulangan ng pasensya at pagsisikap ay magdudulot ng kawalan ng tagumpay.

20. Hindi na sila nasisiyahan sa nagiging asal ng bata.

21. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

22. Ang talumpati ng senador ay ukol sa mga reporma sa edukasyon.

23. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

24. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

25. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

26. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

27. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

28. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

29. Dahil sa pagtatapos ng isang mahabang relasyon, siya ay puno ng lungkot at panghihinayang.

30. La vista desde la cima de la montaña es simplemente sublime.

31. Hawak nito ang isang maliit na bangos na tig-bebente, sa loob-loob ni Aling Marta.

32. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

33. Il fait beau aujourd'hui, n'est-ce pas?

34. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

35. Break a leg

36. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

37. Emphasis is often used in advertising and marketing to draw attention to products or services.

38. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

39. Ang mga punong-kahoy ay kabilang sa mga pangunahing likas na yaman ng ating bansa.

40. Limitations can be overcome through perseverance, determination, and resourcefulness.

41. Di natagalan, isinawak niya ang kamay sa nalalabing tubig sa balde.

42.

43. Ano ang pinanood ninyo kahapon?

44. Saan ba? Wala naman ako allergy eh, palusot ko lang.

45. Nagpapantal ka pag nakainom remember?

46. Tumayo siya tapos nagmadaling pumunta sa cr

47. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

48. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

49. Sinundo ko siya at pumunta kami sa ospital.

50. Wala dito ang kapatid kong lalaki.

Recent Searches

audiencenoonkontinentengdalandanditoumabotsabongnakayukosusunodpangarapadoptedhoneymoonsinunodnasuklamcommunicationcitizenbandaimpactedgrowthoverallnagniningningpinapakinggansinagotkinabukasankamimakausapmulighedermahigitsasagutinnagwikangcoalnasundoincludeabut-abottilgangkumapit1920sleaderslumilipadedit:dasaltusongmitigaterektanggulomabangissalitangpaanoisinagotibotonaggalanatinkumakainbatang-batathankawitanheiibabatalentgathertamadnapapatinginagwadorkristobarrocoxviimahuhulisinunud-ssunodmaglarobeingkasamaangkaaya-ayangpagkaraaleukemiakahoykongresoampliaetokamakailannegro-slavesproducirindividualrosariopinilitnoblekumainpaghangadeliciosanag-replyinspirasyonluluwasumiibigmatulungindaanmahiwagamakikitakwartosurveysmurangmagsalitapag-aapuhapasofredkapataganflamencoreportlunaslamane-explainseryosongnamatahimikibinalitangmaliwanagfacilitatingtumatanglawambagsumugodnagtungokombinationmanghikayatpasswordtambayanlettayoreadingrimaskamporeservationboyetfertilizerpangungutyaprosesobakitfull-timenawalaeasycountlesscommunicateworkshoppagbahingasimbitawansupilinkailantemperaturanawalangeksenanakatapatadventlaptopsharingpinabayaanrewardingnetflixlendingalamidbayarananywherekarwahengminatamispollutionhariinaaminpadrekitangminu-minutomakinangtuyongtawaaskwesleypandidirikainlearnsiemprepootpromisekanapologeticexamplelulusognagpanggapmagpaliwanagkaninahikingmaipapautangmakapagempakehalamanratesementeryoakongparingkinalilibinganmaluwagkasokahaponfactoresumakbaylaterjocelyn