Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "ayuda"

1. A quien madruga, Dios le ayuda.

2. A quien madruga, Dios le ayuda. - The early bird catches the worm.

3. Al que madruga, Dios lo ayuda.

4. Ang presidente ng Pilipinas ay nagpabot na ng ayuda sa mga mahihirap.

5. El estudio de la música ayuda a las personas a desarrollar habilidades importantes, como la creatividad, la concentración y la capacidad de trabajar en equipo

6. Gracias por su ayuda.

7. Gracias por tu ayuda, realmente lo aprecio.

8. La conciencia nos ayuda a entender el impacto de nuestras decisiones en los demás y en el mundo.

9. La conciencia nos ayuda a ser responsables de nuestras acciones y decisiones.

10. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

11. La diversificación de cultivos ayuda a reducir el ries

12. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

13. La obra social produjo una gran ayuda para los más necesitados.

14. La paciencia es una virtud que nos ayuda a ser mejores personas.

15. La paciencia nos ayuda a controlar nuestras emociones.

16. La rotación de cultivos es una práctica agrícola que ayuda a mantener la salud del suelo.

17. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

18. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

19. Nag mungkahi naman ang Mayor na dapat unahin munang bigyan ng ayuda ang mga senior citizens.

20. Napakahaba ng pila para sa mga kumukuha ng ayuda.

21. Seguir nuestra conciencia puede ser difícil, pero nos ayuda a mantenernos fieles a nuestros valores y principios.

22. Wala na akong natitirang pera, umaasa na lang ako sa ayuda.

Random Sentences

1. Sumakay ka sa harap ng Faculty Center.

2. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

3. Arbejdsgivere tilbyder træning for at forbedre medarbejderes færdigheder.

4. Naging kasangkapan ng mga Espanyol ang Katolisismo upang lalong mapadali nila ang pamamalakad dito.

5. Les devises étrangères sont souvent utilisées dans les transactions internationales.

6. Bumaba ako sa basement ng bahay at nagitla ako nang biglang mag-on ang ilaw.

7.

8. Sinundo ko siya at pumunta kami sa ospital.

9. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

10. Naging masaya naman ang dalawa kahit may kondisyon si Cupid na hindi maaaring makita ang kaniyang mukha.

11. Inabot ko naman yung pinggan. Anim na hotdog ang nandun.

12. Sa ganang iyo, mahalaga pa ba ang kultura at tradisyon sa modernong panahon?

13. Danau Toba di Sumatera Utara adalah danau vulkanik terbesar di dunia dan tempat wisata yang populer.

14. Kapag bukas palad ka, mas maraming taong magmamahal at magtitiwala sa iyo.

15. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

16. Nariyan sa kahon ang kamiseta mo.

17. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

18. The objective of football is to score goals by kicking the ball into the opposing team's net.

19. Nakapila ako sa bayad center upang magbayad ng kuryente.

20. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

21. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

22. Ibinigay niya ang kanyang tiwala sa akin upang mamuno sa proyekto.

23. He has bought a new car.

24. Yan ang panalangin ko.

25. Bakit ba? Hinde ba ko pwedeng magsungit?

26. Me duele todo el cuerpo. (My whole body hurts.)

27. Los héroes defienden la justicia y luchan por los derechos de los demás.

28. La ganadería y el cultivo de pastos van de la mano en muchas explotaciones agrícolas.

29. Inakalang magtatagal ang kanilang relasyon, pero naghiwalay din sila.

30. Siya si Helena, nag-iisang anak siya nina Haring Bernardo at Reyna Lorena.

31. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

32. The students are studying for their exams.

33. Nasa silid-tulugan ako at nagitla ako nang biglang bumukas ang bintana sa malakas na hangin.

34. Hindi pa ako nakakapunta sa Barcelona.

35. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

36. A palabras necias, oídos sordos. - Don't listen to foolish words.

37. Ang mga tao ay nasiyahan sa nangyari.

38. All is fair in love and war.

39. Bakit siya pa yung kelangan mong pahirapan?

40. This can be a good way to grow your wealth over time, but it also carries risk

41. Marahil ay pagod ka na sa trabaho kaya't dapat kang magpahinga ngayong weekend.

42. Las personas pobres a menudo tienen que trabajar en condiciones peligrosas y sin protección laboral.

43. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

44. Hindi pinakinggan ng Ada ang abuhing Buto ng Kasoy.

45. The meeting was cancelled, and therefore he had the afternoon off.

46. The heavy traffic on the highway delayed my trip by an hour.

47. El cultivo de frutas tropicales como el plátano y la piña es común en países cálidos.

48. Tumaba sila ng tumaba hanggang sa tuwing maliligo kahit na pa tatlong tao lang sa sapa ay umaapaw agad tubig.

49. Ang kalayaan ay nagbibigay sa atin ng kakayahang magpasya at magplano para sa ating sariling kinabukasan.

50. Las escuelas son lugares de aprendizaje para estudiantes de todas las edades.

Recent Searches

ayudasimplengcafeteriafrasumarappasyasigashapingsentencescientistsay,nagbabagasambitbulongsalapistoresalamangkerosumapitmakilingmagbungaritobellinumin18thprosperdaanrevolutioneretcreationfencingrepresentedworkdayipapahingapartpromotingabsbreakrolledpunong-punoprogrammingpostcardpootpollutionpogipinakamatabangpetsangpeterperyahanpedroparagraphspang-araw-arawpalaypakpakpakelampagtinginpagmasdanpagkatapospagkatgownpag-ibigpag-aminoperahanochandojunjunrangenoohighestbandadraft,charitablebacknilolokouniquemuchstatingnicenglalabanawawalalagnatgumigisingnatutuwamasaktannatinagvidtstraktimprovementtumigilpaoshopepagbigyaninagawfysik,natatawanasabingnapakalusognangingitngitnanghihinamadnanghahapdinakakatandanakakaanimnahulinaguguluhannagsusulatnaglaonnaghuhumindigshowfatperangiconbugtongmuchasmapuputicallersumindichoicenagbasasumusunonag-uwioliviaearnconnectingwalangumingithearnabasamedievaltonighthidingmoviesmitigatemetodemedisinamartialmakinigmakatulogmakatarungangmaintindihanmainitmahiwagangmagpasalamatmagkanomaghatinggabimagdamaganmadamimacadamiamabagallungsodlunetalumikhalolaleaderslangostalalolagikumirotkumaliwakontrataklasengkinakabahankasinggandakasingmanlalakbaysalu-salosportskasamaikinasasabikkarununganmaipantawid-gutomnaglalatangkapagkalayaankahilinganjuliusjulietjapandogsjamesiwinasiwasdiscipliner,itutolkahaponnakaririmarimnakikianagnakawiskedyulnakatirahinawakannasasabihanisipindependentlyenfermedades,inaabutanimpactedilocosiginitgithuertohellohandaanhahahagutombwahahahahahagumising