Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "umimik"

1. Dahil alam niyang galit na ang kanyang ina ay di na umimik si Pinang.

2. Hindi umimik si Aling Marta habang minamasdan ang bata.

3. Hindi umimik si Lory sa mga tanong ni Chad.

Random Sentences

1. Mange mennesker bruger påskeferien til at besøge kirkegårde og mindes deres kære.

2. Up above the world so high,

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. Hindi ako komportable sa mga taong nagpaplastikan dahil alam kong hindi nila ako tunay na kakampi.

5. Kumakain ka ba ng maanghang na pagkain?

6. Dette er med til at skabe en høj grad af social tryghed for befolkningen, og det er også med til at sikre, at Danmark har en lav arbejdsløshed

7. Chumochos ka! Iba na pag inlove nageenglish na!

8. Tengo dolor de garganta. (I have a sore throat.)

9. Hindi ako sang-ayon sa pagtrato ng ibang mga tao sa kanilang mga kapwa.

10. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

11. Gutom ka? kinagat ko ang labi ko at tumango sa tanong nya.

12. Ang daming pusa sa bahay nila Jocelyn.

13. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

14. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

15. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

16. Nasa ibabaw ng mesa ang bag ni Clara.

17. Gumamit ang albularyo ng dahon ng bayabas upang linisin ang sugat ni Pedro.

18. Seek feedback, it will help you to improve your manuscript

19. Kebahagiaan adalah hasil dari kepuasan, keseimbangan, dan rasa bersyukur atas apa yang kita miliki.

20. Mahirap magsalita nang diretsahan, pero ito na - crush kita.

21. El agua es esencial para la vida en la Tierra.

22. All these years, I have been working to make a positive impact on the world.

23. They have been cleaning up the beach for a day.

24. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

25. She is not learning a new language currently.

26. Sana ay maabot ng langit ang iyong mga ngiti.

27. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

28. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

29. Bilang paglilinaw, ang parangal ay ibibigay sa buong grupo, hindi lamang sa isang tao.

30. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

31. The pretty lady in the park was surrounded by admirers.

32. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

33. La tos puede ser un síntoma de cáncer de pulmón.

34. Kailan libre si Carol sa Sabado?

35. Ano ang pinabili niya sa nanay niya?

36. El que espera, desespera.

37. The invention of the telephone led to the creation of the first radio dramas and comedies

38. Esta comida está demasiado picante para mí.

39. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

40. La fotosíntesis es el proceso mediante el cual las plantas convierten la luz solar en energía.

41. Agad silang nagpunta kay Tandang Isko, ang arbularyo sa katabing bayan.

42. I've been driving on this road for an hour, and so far so good.

43. Hindi ko alam kung nagbibiro siya.

44. Motion kan udføres indendørs eller udendørs, afhængigt af ens præferencer og tilgængeligheden af ​​faciliteter.

45. May limang estudyante sa klasrum.

46. Baket? Gusto mo na ba akong umuwi? balik tanong niya.

47. Kapag bukas palad ka sa mga taong hindi mo pa nakikilala, mas maraming taong pwedeng maging kaibigan mo.

48. Hinatid ako ng taksi sa bahay ni Mrs. Lee.

49. At være transkønnet kan være en udfordrende, men også en berigende oplevelse, da det kan hjælpe en person med at forstå sig selv og verden på en dybere måde.

50. Hindi niya inaasahan ang biglaang pagbisita ng kanyang kaibigan.

Recent Searches

pagbabasehanumimikvigtigpanonoodbakalhigpitanhimutokpicturekamukhalintekginamotkulay-lumotmatariksugatdinaananbumilisvarietyumaalispolvosminahanmamayareviewparisukatkampoforskelligepakanta-kantangusingkanilangsumpasaradoestudiotessbeerkahonsearchtutubuinsaanggeardanzaapocameraakomabangoisdabinatatangekshealthierprogrammingpermitepartecuentadrinksnightbesidesconbyeposts,drowingfoundpag-alagakaaya-ayangbawalnamnaminimpactnagbibiroopisinainirapantagalogwalaantokabigaelgawinactorlakingdomingtime,nicoadverselandekumampipunung-punosupportmillionslabing-siyammalamigmag-babaitmind:nakapagsabihadkulangreadersprotestakaininibat-ibangpinakamatunognaglulusakrollpassiongawingklimalilipadgas4thmuchtatayobeforeeeeehhhhkumakainexhaustedinihandasumugodsumangisinarapanlolokoadoptedilogarghamokapatidmaligopinagmasdanogsådespitenayugalipostcardrevolutionizedpagpanhikagadharipamilyamakinighimihiyaw1920smagtiwalasettingdilaginvesting:nakikisalotonyalttilskrivesnapatinginmalagosakristannaiwancultivonutrientes,nadamainterests,napakatagalconsideredlungkotmagtagokauntingnagmakaawatilanagtagpobiglangmagpa-checkupmagpahabagumagawalalimalilainsakupinplatolegendpitosinunud-ssunodmakitapanunuksongsistemasaccuracynangumbidamatandapagsalakaydecisionsresourcesbitawaneducativasnapadpadjuanitopagkakapagsalitablazingunitedluzpinadressligawanmoodnaiwangyelopagsasalitatobaccopasyatelevisedmagitingkasalukuyanpulang-pulaarbejder