Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "patay"

1. Ang apoy sa kalan ay nagbabaga pa rin kahit patay na ang apoy.

2. Ang lolo at lola ko ay patay na.

3. Kaya't iyon ang naging dahilan kung bakit kinamumuhian niya ang kanayang ama at itinuring na patay na ito

Random Sentences

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. She burned bridges with her friends by spreading gossip about them.

3. Sa paglutas ng mga palaisipan, mahalaga ang pag-iisip nang malikhain at pagpapakita ng kahusayan sa loob ng isang patlang.

4. Kaya't tama lamang na ito rin ay kanyang ipapamana sa nag-iisang anak.

5. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

6. Sumasakit na naman ang aking ngipin.

7. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

8. Kinasuklaman ako ni Pedro dahil sa ginawa ko.

9. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

10. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

11. Mie goreng adalah mie yang digoreng dengan bumbu-bumbu khas Indonesia hingga terasa gurih dan pedas.

12. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

13. Mabuti na lamang ay sinunod nya ang alituntunin ng kanilang paaralan.

14. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

15. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

16. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

17. Transkønnede personer kan vælge at gennemgå hormonbehandling og/eller kirurgi for at hjælpe med at tilpasse deres krop til deres kønsidentitet.

18. A continuación se detallan los pasos para cultivar maíz en casa o en un pequeño huerto

19. A veces tengo miedo de tomar decisiones, pero al final siempre recuerdo "que sera, sera."

20. Don't beat around the bush with me. I know what you're trying to say.

21. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

22. Mahusay mag drawing si John.

23. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

24. Sa aming mga tagumpay, nagbabahagi kami ng kaligayahan bilang magkabilang kabiyak.

25. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

26. Ang mga kabayanihan ng mga sundalo at pulis ay kailangan ituring at kilalanin bilang mga halimbawa ng tapang at dedikasyon.

27. Muchas personas prefieren pasar el Día de San Valentín en casa, disfrutando de una cena romántica con su pareja.

28. Si Jose Rizal ay napakatalino.

29. Nationalism can also lead to a sense of superiority over other nations and peoples.

30. The writer published a series of articles exploring the topic of climate change.

31. Nagtagumpay siya dahil sa lakas ng loob na hinugot niya sa kanyang karanasan sa buhay.

32. Sa kanilang panaghoy, ipinakita nila ang tapang sa kabila ng matinding pagsubok.

33. La santé des femmes est souvent différente de celle des hommes et nécessite une attention particulière.

34. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

35. Pinagpalaluan ng mga empleyado ang kanilang manager dahil sa kanyang mahusay na pamumuno.

36. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

37. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

38. Estoy sudando mucho. (I'm sweating a lot.)

39. Batman, a skilled detective and martial artist, fights crime in Gotham City.

40. Nang sumapit ang ika-12 ng hating gabi, nagpalit ng anyo ang kakaibang pusa.

41. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

42. La science des données est de plus en plus importante pour l'analyse et la compréhension de grandes quantités d'informations.

43. Los powerbanks son una solución práctica y conveniente para mantener los dispositivos electrónicos cargados cuando se está fuera de casa.

44. Superman possesses incredible strength and the ability to fly.

45. Ang panaghoy ng kalikasan ay naririnig sa bawat pagkalbo ng kagubatan.

46. Bago pa man napigilan ng bata ang babae ay naisubo na nito ang puting laman ng bunga.

47.

48. Ang taong maramot ay madalas hindi sinasamahan ng iba.

49. Sorry, hindi ako babae eh. sumubo ako ng pagkain ko.

50. Un powerbank es un dispositivo portátil que permite cargar dispositivos electrónicos.

Similar Words

Napatayo

Recent Searches

kinantalinawpataynaupogabiconnectinggabi-gabiscientifictonnatanggapulambilinkabibiminutowordlayaskantomakisigmenosbecomingweddingibonnagbasapetsangsamakatwidpangingimivotesitakuncheckedibalikbumababapingganconectadosroonabisubjecttabiaddressjeromecoachingdedication,labingdolyarsinabibrucebagongmalungkotmamayamayroongclientescrossfascinatingexiteducationalsagingmulti-billionipapainitstrengthhardyangsamang-paladipinalitgraduallyhapdibasaandystyrermapdebatesmarkedechavehalostaoslibrohalakhakkamakailannakusamantalangroboticsnoongnakapamintanaaddpolonagpaalamcoatnakatirangjackybikolcellphonereaksiyonlamang-lupanahulikitamatigaspagkaingnakakapagodpanahonkatamtamankapagbiglangtumatawabalitatalanararapatmagalangsonidoapollostoplightexhaustionhinabalabanmangungudngodkomunidadkatutuboauditsocialelibagiyogalakinuulcertumaggapminamadalipinakamahalagangnakakunot-noongibinubulongsasagutinmedya-agwanagpapaigibtinaasannagtutulaknapapatungoambisyosangmalapalasyokasintahanmahinanglumikhanapanoodkumidlatnakatagosallydatapwattahimikkinumutanvideosnagdabogmakabilihayaangkisspagamutankongresoawitaniyamotmismomaghihintay1970shinamakkakilalagumigisingevolucionadokapintasangretirarsampungrightsmasungitmassachusettsnanigashistoriapakilagaybenefitsiikotiba-ibangalinnakahugpublishingbutokumustacocktailparoroonamoneynatigilanbunutanbopolsmagdaanmahigitbalotkatagalansapatbinibilangamendmentsmatayogtomorrowganidwednesdayhinaboldogscomputere,konghappenedalamidpakealam