Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "fake news"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

3. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

4. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

5. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

6. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

7. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

8. Laganap ang fake news sa internet.

9. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

10. Receiving good news can create a sense of euphoria that can last for hours.

11. Sa ganang iyo, dapat bang palakasin pa ang kampanya laban sa fake news?

12. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

13. The news might be biased, so take it with a grain of salt and do your own research.

14. The stock market can be influenced by global events and news that impact multiple sectors and industries.

15. The traffic on social media posts spiked after the news went viral.

16. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

17. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

Random Sentences

1. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

2. Humingi siya ng makakain.

3. Sa soccer, sinipa ni Andres ang bola papasok sa goal.

4. Mataba ang lupang taniman dito.

5. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

6. Ikaw ang iniisip ko bawat oras ng buhay ko.

7. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

8. Nakakatuwang malaman na maraming kabataan pa rin ang nakikinig at nakakatuklas ng kagandahan ng mga kanta ng Bukas Palad.

9. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

10. Oo naman! Idol ko si spongebob eh.

11. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

12. Bis morgen! - See you tomorrow!

13. ¡Hola! ¿Cómo estás?

14. Di mana bumi dipijak, di situ langit dijunjung.

15. Before a performance, actors often say "break a leg" to each other for good luck.

16. Higit kong daramdamin kung ako na itong nagawan ng di mabuti ay sa kanya pa manggagaling ang huling salita.

17. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

18. Binili ko ang bulaklak para kay Ida.

19. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

20. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

21. Bantulot niyang binawi ang balde, nakatingin pa rin kay Ogor.

22. The objective of football is to score goals by kicking the ball into the opposing team's net.

23.

24. Napakamot na lang ng ulo si Kenji.

25. Halos wala na itong makain dahil sa lockdown.

26. Itinuturo siya ng mga iyon.

27. She has excellent credit and is eligible for a low-interest loan.

28. Ano ang nasa tapat ng ospital?

29. Ang utang ay maaaring maging mabuting paraan upang matugunan ang mga pangangailangan sa panahon ng kawalan ng sapat na pera.

30. Acara keagamaan, seperti perayaan Idul Fitri, Natal, Nyepi, dan Waisak, dihormati dan dirayakan secara luas di Indonesia.

31. Not only that; but as the population of the world increases, the need for energy will also increase

32. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng kasiyahan at kaganapan sa aking buhay.

33. Ang mumura ng bilihin sa divisoria.

34. Ipinagtanggol ng mga obispo ang doktrina ng purgatoryo sa kanyang homiliya.

35. Tengo dolor de oídos. (I have ear pain.)

36. Maliksi siyang lumapit at binatak ang bata sa liig.

37. Ikinuwento niya ang nangyari kay Aling Pising.

38. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

39. Les soins de santé de qualité sont un droit fondamental de chaque individu.

40. They offer interest-free credit for the first six months.

41. The bakery specializes in creating custom-designed cakes for special occasions.

42. The website's online store has a great selection of products at affordable prices.

43. Ang taong maramot ay madalas hindi sinasamahan ng iba.

44. Transkønnede personer kan vælge at gennemgå hormonbehandling og/eller kirurgi for at hjælpe med at tilpasse deres krop til deres kønsidentitet.

45. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

46. I know I'm late, but better late than never, right?

47. Bagaimana kondisi cuaca di sana? (What is the weather condition there?)

48. The hotel room had an absolutely stunning view of the city skyline.

49. Ang kaniyang pamilya ay disente.

50. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

Recent Searches

tilipagkakapagsalitapasaheroalas-diyeslumiwagnalalamanpapagalitankinauupuangnagtatanongkasalnagsunurannagmungkahikalakihankahirapanfilmpaghihingaloteknologiexportkatawangdumagundongnakatapatiwinasiwasmanghikayatinvesting:nakasahoddisenyongnakatitiginaaminpinapatapospaghahabikissprimerosnasasalinandeliciosapakikipagbabagyoutube,hiwapinakidalamagpapabakunapulang-pulawriting,tumatawadkasamaangbinentahanbinuksannagtapossementongsenadorrektanggulopersonasnahigitanmawalasikatmaynilaminahanfavorparaanggagamitkundimantirangkumainkoreapadalaspagkamulatkainismatikmantanawallearegladomamarildadalomabuticoughingcitydiligininnovationpasadyabuhokmakulitenerodesarrollartsupermaghahandakendikunwailagayself-defensebinibiliapologeticmagnanakawninongshinesjenadikyamsumingitadditionally,inatakebalangpasensyakahusayanaddictionmabaitmarumimahiyapagpasoklikesparkingpakilutomalambingsinumangkumukulobritishcoalbumigaypatayrevolutionizedlenguajeradiokaykantodesisyonanmassesdulotgrinspetsangcinewereasthmasolarpepemahalmarchrestawanwestpakelamspentbrindarpshgearbagyoreaderssaidgatheringmatiyakfacultylupalopadditionallystudentslumapitdevicesmapapaactingsarilingtrackeasiersumalispalatercoaching:bulaklakilingrequiredoingeditorfallavanthreelightstelevisedbinabacasespilingcompletenapatunayanprovidemakabawigarbansosbumibilinaglinissupremeku-kwentafraasiarelodumilatnakadapabayarankawayanbanlagkanantumaggaptinikmanpangakoblogmundomaglabasadyang,entertainmentmasayang-masayakindergarten