Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "professional"

1. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

2. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

3. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

4. Football is a popular sport for both men and women, with many professional women's leagues around the world.

5. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

6. He admires the athleticism of professional athletes.

7. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

8. It can be helpful to get feedback from beta readers or a professional editor

9. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

10. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

11. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

12. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

13. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

14. Scissors can be sharpened using a sharpening stone or taken to a professional for sharpening.

15. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

16. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

17. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

18. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

19. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

20. The professional athlete signed a hefty contract with the team.

21. Work can also provide opportunities for personal and professional growth.

Random Sentences

1. Scissors can have straight blades or curved blades, depending on the intended use.

2. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

3. Anong wala! pasinghal na sabi ni Aling Marta

4. Paano kayo makakakain nito ngayon?

5. The cake you made was absolutely delicious.

6. Nasa kanan ng bangko ang restawran.

7. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

8. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

9. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

10. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

11. Ang pangamba ay maaaring maging mabuting tagapag-ingat upang maiwasan ang posibleng peligro.

12. Ketika dihadapkan pada tantangan, penting untuk memiliki sikap positif dan optimis.

13. Sa probinsya, maraming tao ang naglalaba sa ilog o sa bukal.

14. Malinis ang kuwarto ng mga magulang ko.

15. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

16. Sa pagtulog, ang utak ay nagpapahinga at nagpaproseso ng mga impormasyon na natutunan sa buong araw.

17. La labradora de mi vecino siempre se emociona cuando ve a alguien llegar a casa.

18. Saan ho ba ang papuntang Manila Hotel?

19. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

20. May mga taong may agam-agam sa mga pangarap nila sa buhay kung ito ba ay magkakatotoo o hindi.

21. Ito ang barangay na pinamumunuan ni Datu Diliwariw.

22. Hindi sila makaangal sa di makatarungang pagpapautang.

23. Las vacaciones son una oportunidad perfecta para desconectar del trabajo.

24. Ang pagmamalabis sa pag-inom ng alak ay maaaring magdulot ng mga problemang pangkalusugan at personal.

25. El agua es esencial para la vida en la Tierra.

26. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

27. Microscopes are also used in materials science and engineering to study the microstructure of materials.

28. She does not smoke cigarettes.

29. In the years following his death, Presley's legacy has continued to grow

30. When he nothing shines upon

31. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan.

32. Patuloy ako sa paglinga nang may mamataan ang mga mata ko.

33. Magkano ho ang arkila ng bisikleta?

34.

35.

36. Pinili ng mga magulang ang pinakamalapit na paaralan sa kanilang tahanan upang hindi na mahirapan ang mga bata sa pagbiyahe patungong silid-aralan.

37. Maaliwalas ang mukha ni Lola matapos siyang bisitahin.

38. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa kalusugan ng sanggol kung ang isang buntis na babae ay gumagamit ng droga.

39. They are not shopping at the mall right now.

40. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

41. Mahusay na mahusay kumita ng pera si Kablan.

42. Eine schlechte Gewissensentscheidung kann zu Konflikten und Schwierigkeiten führen.

43. Ahhhh ok. Ilan ba ang kapatid mo? tanong ko.

44. Es un placer conocerte, ¿Cómo te llamas?

45. Ang nagtutulungan, nagtatagumpay.

46. Tesla is an American electric vehicle and clean energy company.

47. Certaines personnes sont prêtes à tout pour obtenir de l'argent.

48. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

49. Sama ako. inulit nya lang ang sinabi nya.

50. Itinali ng hari ang batang higante at pinakawalan ang mga taong nakakulong sa kuweba.

Recent Searches

professionalopportunitiesrelievedpetermichaelhimselforderlikelychefgenerateeksamhowevernasaprogrammingprogramming,currentrememberconditioninaapihalosalignsnicerelevantbeforemang-aawittinaasanpagkakakawitniyamenunaninirahanestablishnaglalakadbalitapagdukwangyakapinnagkapilatsundaloskirtnaghilamoskakilalanatatanawiiwasanhinagisninamarielannikamagdaancalidadpangkatnanaykargangpaitspecialbriefpasankinsealaalatseconventionaloftepangulobulaarmedmonetizingsequenakaupomatariknasasakupanmanlalakbaypdacementinangatdaramdaminpagtinginpioneerkartonisinusuotpagkagisingvehiclesactualidadtinakasanlever,matumalatentophilippinegivedepartmentlibertypangalananminervietindighinahaplosbumagsakmatipunodisposalphilanthropymataasklasengkenjiparebibilipulitikolumutangespecializadassinampalnilulonhinugothamaknapatunayanguideanimrecentsteernasundomotionstylesendsecarsedinalametodebabasumasakaylaruinabut-abotlumilipadpartskongresoprodujomagsugalinuulceryumabangpamasahehoneymoonnapakahangapagkakapagsalitanagsimuladespuesbestfriendnananalonasasabihanaanhinnakatiraalas-diyessimbahannaglipananghila-agawanpapanhikisinulatmagkaibigannakaka-intaga-nayonkahirapankasaganaannakaluhodhumalakhaknagliliyabmakikitanagngangalangtatagalnakakatabapakikipagbabagnauliniganparehongnapipilitannagkalapitcrucialdiscipliner,nakatalungkomaabutanautomatiskmasasabipabulongnagsineunidosopisinausuariopaglulutopinangalanangre-reviewpinatidpaakyatsahodsidogustongnatigilanbaronggrocerymakausapairplanespaglayassabongiyamotmagisippatawarinpagdiriwangsamantalangnaiiritangpagbabantakastilanginsidente