Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "professional"

1. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

2. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

3. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

4. Football is a popular sport for both men and women, with many professional women's leagues around the world.

5. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

6. He admires the athleticism of professional athletes.

7. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

8. It can be helpful to get feedback from beta readers or a professional editor

9. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

10. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

11. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

12. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

13. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

14. Scissors can be sharpened using a sharpening stone or taken to a professional for sharpening.

15. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

16. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

17. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

18. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

19. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

20. The professional athlete signed a hefty contract with the team.

21. Work can also provide opportunities for personal and professional growth.

Random Sentences

1. Sa tapat ng posporo ay may nakita silang halaman na may kakaibang dahon.

2. La paciencia es la clave para conseguir lo que deseamos.

3. "A house is not a home without a dog."

4. Once upon a time, in a faraway land, there was a brave little girl named Red Riding Hood.

5. Ang pangamba ay maaaring maging dahilan ng hindi pagpunta sa mga lugar na hindi pamilyar sa atin.

6. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

7. Tumatawa pa siya saka pumikit ulit.

8. Brad Pitt is known for his charismatic performances in movies such as "Fight Club" and "Ocean's Eleven."

9. The festival showcases a variety of performers, from musicians to dancers.

10. Mahirap hanapin ang katotohanan sa kaibuturan ng kaso.

11. Nagbabaga ang araw sa gitna ng tanghali, dahilan upang mabilis na matuyo ang mga damit.

12. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

13. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

14. Nagpapakain ako ng aking aso sa hatinggabi bago kami pareho matulog.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. Un powerbank completamente cargado puede ser una fuente de energía de respaldo en caso de emergencia.

17. Tengo fiebre. (I have a fever.)

18. Kailan at saan ipinanganak si Rene?

19. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

20. Ang kamatis ay mayaman din sa vitamin C.

21. Algunos fines de semana voy al campo a hacer senderismo, mi pasatiempo favorito.

22. Tumitigil lamang ito sa gabi upang makapagpahinga ang mga hayop upang sa susunod na araw ang may lakas sila upang ipatuloy ang pakikipaglaban.

23. Nahuli ang salarin habang nagtatago sa isang abandonadong bahay.

24. Il est important de prendre en compte les risques potentiels et de faire des recherches approfondies avant de décider de participer à des activités de jeu.

25. Dinala niya ang regalo sa tarangkahan ng bahay ng kaibigan niya.

26. Madalas banggitin si Carlos Yulo sa mga balita tuwing may malaking kompetisyon.

27. ¿Qué edad tienes?

28. El powerbank utiliza una batería recargable para almacenar energía.

29. Sa loob ng bilangguan ay doon rin niya nakilala ang isang pari, si Padre Abene

30. Las hojas de los árboles cambian de color en otoño.

31. Lebih baik mencegah daripada mengobati.

32. At have håb om en bedre fremtid kan give os troen på, at tingene vil blive bedre.

33. Ang mailap na kapalaran ay kailangan tanggapin at harapin ng may lakas ng loob.

34. Ada beberapa tradisi dan kepercayaan terkait kelahiran di Indonesia, seperti menjaga diri dan pola makan selama masa kehamilan.

35. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

36. It's wise to compare different credit card options before choosing one.

37. Salamat na lang.

38. Magsabi ka ng totoo, kung di ay dadalhin kita.

39. He does not waste food.

40. Matayog ang pangarap ni Juan.

41. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

42. I am teaching English to my students.

43. Nagpatawag ng pagpupulong ang guro sa silid-aralan upang pag-usapan ang mga plano para sa darating na taon.

44. Ang palaisipan ay isang uri ng suliranin na nangangailangan ng matinding pag-iisip upang malutas.

45. Siya ay hinugot ng mga pulis mula sa kanyang bahay.

46. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

47. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

48. Kapag aking sabihing minamahal kita.

49. Nagtanghalian kana ba?

50. Hindi dapat mawala ang kalayaan sa pagpili ng ating sariling relihiyon at pananampalataya.

Recent Searches

professionaleasiergreenwarishiftprocesswhiletypessalapirememberkasingelectthreenotebookgenerationssteerbeforebaldedoonpinilingfurtherpigingkanawatchnaghihinagpisbalangkinalalagyannagpuntamagazineswakaspamahalaaniniindamayabongkisapmatagapkaparehasinabiparkemgauuwinapakamisteryosodalawabingominamasdanbakuranampliasundaenaabotestarkumalmamagmangungudngodkagatolpumulotmatindingpa-dayagonalpinapalogalakakingconclusion,i-collectsahigextremistbillfertilizermasasamang-loobculturessiglodulotugattalinoninaisfilmsmadadalapiyanopusopalibhasatwo-partychefmagpa-ospitalworkshopmagbabalasikkerhedsnet,alinnanamannagkasakitakokamandagmagagawainsektongminamahalpumapaligidpupuntahankalayuanna-suwaytinangkaestudyantenagpabayadbusyangmulighednyaabalasinipangeithercaresilbingdoktorprimertoothbrushritoumagakainnandayatabingsaranggolatabasagam-agamlikasmagbagong-anyogratificante,naupotiniradorkikitanegosyantenagkwentotumahimikkadalagahangmagkakailanakapagsabinangampanyanakakainnahintakutannakatindigmatagpuanguitarranapipilitanmahuhusayumiinomkasintahannakuhaprovidedcalidadmatatagandrewdistanciamagsasakaasignaturapagsagotlondonmagpapigilmagtagovillagetumiranangangakosuzettenaaksidentepabulongnasaankaramihansagutinisinuottinataluntonkontinentengopisinasagabaldisensyokagubatanbulalaspaanotig-bebeinteiyamottumingalalalargapaliparincruzkailannangapatdannakatiramatutulogkastilamensbinabaratcommercialpakilagaydescargarmusicalpinaulananpananakitpulongopportunitygowncashbopolslittlenatigilanpakainincompletamentekaniyaalintuntuninelena