Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "certain"

1. High blood pressure is more common in older adults and those with certain medical conditions.

2. I am absolutely certain that I locked the door before leaving.

3. Il existe un certain nombre d'organisations et de programmes qui offrent de l'aide aux personnes luttant contre la dépendance au jeu.

4. Leukemia can be caused by genetic mutations or exposure to certain chemicals or radiation.

5. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

6. Presidential elections are held in November and involve a system of electoral votes, where each state is allotted a certain number of votes based on population

7. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

8. Some dog breeds are better suited for certain lifestyles and living environments.

9. Some people argue that it's better not to know about certain things, since ignorance is bliss.

10. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

Random Sentences

1. Napuyat ako kakapanood ng netflix.

2. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

3. Inflation kann dazu führen, dass Unternehmen Schwierigkeiten haben, Kredite zu erhalten.

4. "A dog is the only thing on earth that loves you more than he loves himself."

5. Matapos ang mahabang panahon ng paghihintay, ang aking pag-aabang ay napawi nang dumating ang inaasam kong pagkakataon.

6. Hindi niya gustong maging nag-iisa sa buhay.

7. May malawak na lupain ang kanyang mga magulang.

8. Knowledge is power.

9. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

10. Ang awitin ng makata ay puno ng hinagpis na naglalarawan ng kanyang pagkabigo sa pag-ibig.

11. Nang magkasalpukan ang dalawang sasakyan, aksidente niyang naipit ang kanyang kamay sa pinto.

12. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

13. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

14. Kung may tiyaga, may nilaga.

15. Rapunzel is a girl with long, magical hair who is locked in a tower until a prince comes to her rescue.

16. Mula sa bintana ng mga barungbarong, nakikita niyang nagsusulputan ang ulo ng mga bata.

17. The team's colors are purple and gold, and they play their home games at the Staples Center.

18. Omelettes are a popular choice for those following a low-carb or high-protein diet.

19. Sino ang pupunta sa bahay ni Marilou?

20. Dogs can develop strong bonds with their owners and become an important part of the family.

21. Pumunta ako sa Iloilo noong tag-araw.

22. Iyon hong hinog na mangga. Magkano ho?

23. He has been working on the computer for hours.

24. Ang mga hudyat ay maaaring maging bahagi ng kultura at lipunan, na may iba't ibang kahulugan sa iba't ibang konteksto.

25. Ano ang inireseta ng doktor mo sa iyo?

26. Taksi ang sasakyan ko papuntang airport.

27. Ikinasuklam ko ang ginawa ni Pedro.

28. Kumanan kayo po sa Masaya street.

29. Maria, si Ginang Cruz. Guro ko siya.

30. Aling telebisyon ang nasa kusina?

31. El cultivo de café requiere de un clima cálido y suelos fértiles.

32. Las vacaciones son una oportunidad perfecta para desconectar del trabajo.

33. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

34. Las hierbas medicinales se utilizan desde hace siglos para tratar diversas dolencias.

35. The wedding cake was beautifully adorned with fresh flowers.

36. Electric cars can have positive impacts on the economy by creating jobs in the manufacturing, charging, and servicing industries.

37. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

38. He also believed that martial arts should be used for self-defense and not for violence or aggression

39. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

40. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

41. Pedro! Ano ang hinihintay mo?

42. I have finished my homework.

43. Inakyat ng bata ang puno at tinikman ang bunga.

44. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

45. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

46. Pakibigay na lang sa punong-guro ang liham ng mga magulang mo.

47. Hindi ako sang-ayon sa pagtrato ng ibang mga tao sa kanilang mga kapwa.

48. The bridge was closed, and therefore we had to take a detour.

49. Nasan ka ba talaga?

50. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

Recent Searches

alignscertainumangatnagbabasaayonkarunungandumimatipunoconmagkaibangtatagalbaolitomodernkumalasincreasesbeyondmaratingorderchecksconstitutionibabawmejorepresentativessertulisannagsamaminatamisnagbabalasiguradomaibibigaylumutangkontratasalbahengnaglulutona-fundtinutopnaglokokarwahengmagsusunuranagam-agambibisitanakalilipaspaumanhinnapanoodinferioresinaabutanpagkabuhaynagnakawcultivarsupilinstreamingroofstockniyonrewardingmaskinerafternoonguerrerocanteenbinuksanmobilepesosipinambiliincredibledumilatnagplaygawingemocionalkapwaestilosguidancekainismaglabakaybilisaustraliapayongbukodkatandaanagadklasrumbalancesnatandaangoshkagubatananywherepsssdissesiglonetflixhoypublishing,tilamulighedburgersamfundfuelpopularizeproductionespigasbugtongcuentanleukemiafrareducedmoodabonobosesstandbubongfateveningyesirogitinakdangnasasabihanmatutongcompletegabrielnagingistasyonleftnakikilalangmalapitwakasnakasandigcornercasesputahenasundobilervictoriabinentahankargahanpasaherotumaposnanggagamotlaryngitiscontestattractivepinabayaannakahigangbulatereaksiyonnakatuwaangpagkakayakapkomunikasyonnapakatagalnagpapasasaosakamakikikainhandaanaktibistapupuntahanmagkasamapartsmakasalanangricapalancanapahintonakatuonbutikikontinentengpagtatakafacemasknagniningninglunasmabigyanalangansubject,diseasesbandaupuanmaubosexperts,hinintaybaguioanungagostorequierenrenaianakitulogbalikditobumigayyarikalongahasantokmayroonpropensomedidalumulusobskypepackagingestablishbellandamingbagojudicialtaba