Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "since"

1. Amazon started as an online bookstore, but it has since expanded into other areas.

2. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

3. Electric cars have lower fuel costs than gasoline-powered cars since electricity is generally cheaper than gasoline.

4. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

5. Since curious ako, binuksan ko.

6. Since wala na kaming naririnig medyo kumalma na ako.

7. Some people argue that it's better not to know about certain things, since ignorance is bliss.

8. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

9. The telephone has undergone many changes and improvements since its invention

10. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

11. They have been friends since childhood.

12. They have been playing tennis since morning.

Random Sentences

1. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

2. Magandang Gabi!

3. Bahay ho na may dalawang palapag.

4. Nagtayo kami ng aming tindahan, bagkus hindi pa ito gaanong kilala ng mga tao sa lugar namin.

5. The first dance between the bride and groom is a traditional part of the wedding reception.

6. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

7. As your bright and tiny spark

8. Mahalaga rin ang pagkakaroon ng kooperasyon at pagtutulungan upang malutas ang mga palaisipan sa isang grupo o komunidad.

9. Paglalayag sa malawak na dagat,

10. La calidad del suelo es un factor clave para el éxito de los agricultores.

11. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

12. Bakit ka nasa hospital?! Sorry kanina.

13. Dette er med til at skabe en høj grad af social tryghed for befolkningen, og det er også med til at sikre, at Danmark har en lav arbejdsløshed

14. El concierto de la orquesta sinfónica fue una experiencia sublime para los asistentes.

15. Sa pagbabasa ng magandang libro, napapasaya at natutulog ako nang matiwasay sa gabi.

16. Bago niya napanalunan ang ginto, si Hidilyn Diaz ay nagwagi na ng pilak na medalya sa Rio Olympics 2016.

17. A father's love and affection can have a significant impact on a child's emotional development and well-being.

18. Sa pamamagitan ng pag-aaral ng kasaysayan, mas naging malalim ang aking kamalayan sa mga pangyayari noong panahon ng Digmaang Pandaigdig II.

19. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

20. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

21. She joined a charitable club that focuses on helping the elderly.

22. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

23. Ang mga bunga ay nagkaroon ng malaki at maraming tinik na katulad ng rimas.

24. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

25. Ang pagtitiyaga sa pagbabayad ng utang ay magdudulot ng kapanatagan sa buhay at magpapalakas ng financial stability.

26. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

27. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

28. El que mucho abarca, poco aprieta.

29. Ang mga engineer nagsisilbi upang mag-disenyo at magtayo ng mga imprastraktura para sa publiko.

30. Kailan siya nagtapos ng high school

31. Technology has also played a vital role in the field of education

32. Les patients sont souvent mis sous traitement médicamenteux pendant leur hospitalisation.

33. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

34. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

35. Las serpientes son carnívoras y se alimentan principalmente de roedores, aves y otros reptiles.

36. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

37. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

38. Ang bawa't isa ay may kanya-kanyang ginagawa.

39. Ang pagkakaroon ng positibong pananaw ay makatutulong sa pagharap sa mga hamon ng buhay, samakatuwid.

40. Sa kanya rin napapatingin ang matatanda.

41. She burned the dinner and then the smoke alarm went off. That just added insult to injury.

42. Don't spill the beans about the project, it's supposed to be a secret.

43. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

44. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

45. El estudio de la música ayuda a las personas a desarrollar habilidades importantes, como la creatividad, la concentración y la capacidad de trabajar en equipo

46. People can also borrow money through loans, credit cards, and other forms of debt.

47. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

48. Nakatingala siya kay Ogor, mahigpit na kinukuyom ang mga palad.

49. Maaliwalas ang langit ngayong umaga kaya masarap maglakad-lakad.

50. Inflation kann die Beziehungen zwischen den Ländern beeinträchtigen.

Recent Searches

bussincefencingreadingcallbeingstartedcontinuedheftykasamajaysonmakikipag-duetonangingilidpoolsamakatwidmanoodkindleledkommunikereriyamotpinapalokamaogatasskyldesfigureslilikobundokguromatanagdiriwangnuonpagdiriwangdoublenagtitindaandamingpadabogroofstocksinipang1920spuwedehalamanbumugamatandausangangelectionscontinuesdiagnosticbanyotaksiyearargueharapanswimminganjophilippinepagiisiphinawakanhouseholdsarabiamagpaniwalakinauupuangmaalogkalagayanmakatulognagbantaynaghihirapnagtatae1970ssugatangkoreasarisaringhihigitkumaengulayvetonahigahumblepinsangamottindabibilhinnapakodetectedcnicomayamangparkingcivilizationpapuntadinimagdaknowspangnangtiposnilolokogumigitibakatherapynagsunuranumagabansangnapabalitaayusinbataydiagnoseshatenagdaosendiwandognakapamintananakabilisigla3hrssiyakaraokeganyanmalikotparehasexhaustiontoosicafanscaninilagaymagkaharapstorekinapanayamsakyanbigongsumasaliwkagandahagmarumingbusiness,pagsasalitamakakatakasalikabukinvideos,bulaklaktatawaglabing-siyaminterests,itinatapatnagsuotpabulongproducetaga-ochandogalaannakisakaybayadamingcombatirlas,balik-tanawmayhinampaskalaropakibigaykainitanbulakaaisshtiniogoalkarapatanhumintobranchalexanderomgnahuliorugafiarosefakematindingeveningnotgamecolourmakilingexpertmedyonakakaalamgandabastanamungaidea:trainingspeechulodecreasetanyaghallharipinanganaknagpadalanutrientspebrerolagunamaunawaanpumiligovernment