Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "last"

1. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

2. All these years, I have been creating memories that will last a lifetime.

3. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

4. Ha? Ano yung last na sinabi mo? May binulong ka eh.

5. Holy Week is a Christian observance that commemorates the last week of Jesus Christ's life on Earth, leading up to his crucifixion and resurrection.

6. I saw a pretty lady at the restaurant last night, but I was too shy to talk to her.

7. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

8. Last full show tayo. Ano bang pinakamalapit na mall?

9. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

10. Oo nga, yung last time eh nung birthday ko pa. ani Genna.

11. Receiving good news can create a sense of euphoria that can last for hours.

12. She surprised me with a cake on my last day of work to bid me farewell.

13. The company acquired assets worth millions of dollars last year.

14. The concert last night was absolutely amazing.

15. There were a lot of people at the concert last night.

16. We should have painted the house last year, but better late than never.

Random Sentences

1. Lights the traveler in the dark.

2. Pinaoperahan namin siya, naging matangumpay naman ang operasyon, ngunit hindi na ito kinaya ng kanyang katawan.

3. El acceso al agua potable es un derecho humano fundamental.

4. Las redes sociales permiten a las personas conectarse y compartir información con amigos y familiares.

5. The novel was a hefty read, with over 800 pages.

6. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

7. Nangagsipagkantahan kami sa karaoke bar.

8. En Argentina, el Día de San Valentín se celebra en el mes de julio.

9. Kung papansinin mo'y lagi ka ngang mababasag-ulo.

10. A, e, nawawala ho ang aking pitaka, wala sa loob na sagot ni Aling Marta

11. Gaano ka kadalas pumunta sa doktor?

12. La persona ebria en la calle está llamando la atención de los transeúntes.

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. The guilty verdict was handed down to the culprit in the embezzlement trial.

15. Mahirap magpapayat kapag mahilig ka sa pulotgata dahil ito ay sobrang tamis.

16. Napakalaking ahas ang nakita ni Anjo.

17. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

18. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

19. Kailan at saan ipinanganak si Rene?

20. Gracias por hacerme sonreír.

21. Ano ang sasabihin mo sa kanya?

22. Ang pag-aaksaya ng pera sa sugal ay isang hindi maipapaliwanag na desisyon.

23. There were a lot of people at the concert last night.

24. Technology has also had a significant impact on the way we work

25. They have been friends since childhood.

26. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

27. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

28. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

29. Påskeæg er en traditionel gave i påsken og er ofte fyldt med slik eller små gaver.

30. The surface of the football field can vary, but it is typically made of grass or artificial turf.

31. The widespread use of the telephone has had a profound impact on society

32. "May sorpresa ako para sa’yo," ani ng tatay sa kanyang anak.

33. Hindi importante kung maganda o pangit ang itsura, ang mahalaga ay hindi kababawan ng kalooban.

34. Nanunuri ang mga mata at nakangising iikutan siya ni Ogor.

35. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

36. May tatlong kuwarto ang bahay namin.

37. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

38. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

39. Humarap siya sa akin tapos nag smile.

40. Tatlong araw bago dumating ang ikatlong Sabado, sorpresa ko siyang dinalaw.

41. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

42. Sa panahon ng digmaan, madalas na nagkakaroon ng migrasyon at pagkawala ng mga tao sa kanilang tahanan.

43. But television combined visual images with sound.

44. Beast. sabi ko pagkalapit sa kanya.

45. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

46. Sa dapit-hapon, masarap tumambay sa beach at mag-enjoy sa tubig.

47. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

48. Si Jose ay na-suway sa simpleng paalala na huwag mangulangot sa harap ng ibang tao.

49. O sige, humiwa sya sa karne, pumikit ka.

50. Have you been to the new restaurant in town?

Similar Words

napaplastikanlasting

Recent Searches

lastiiklinagyayangkasakitmayamannatanongiskosaidnagpapasasaabigaelkuliglighawlamatandangmakipagtagisanhalakhaknagagandahaniyamotturntuyoinfluencesnapakapasensyamagpahababisigdalawininompaglalayagnaglalatangpublishing,gubatpalaynakaakyatpagbabagong-anyomadalingtig-bebeinteemocionalbringingmagulayawsaragagnakiniginspireheregivermakalipastagtuyotnakakagalanagtatakboschoolsnilolokomagkasamaikinamataylongfremtidigedurisinipangtrafficnaibibigaynakapuntaubonagwaginag-aalalanghinanapnawawalanilutoibinentagraphicmanamis-namislargernumerosaspakelamsoundiikottandanglalabamakapagsabitog,kabuhayanelectpaksasellinglalamunanatensyongvoteslcdmagsaingpasinghalnagbasaaidshiftkumakalansingdingginsiglosulyapfeedbackeffectsharapmahinogworryevolucionadomakakakaenkangkongdialledguroinatupagbrasobusloapoykaalamanmadulassiguradomaulitartistssinkoftenpitumpongtumindiglabortirangharimagagandangsamakatuwidpagkaawakayofireworksmesangtumubopinagmamasdanhastamaingatlumitawinvolvedidpalapitnagmistulangmumobiggestlegislativeipinaofteexpressionsiiwasansagingumiyakmonetizingalituntuninkalupibagsaknagbagoihahatidtaun-taonpagbibirofindniyaniparatingfacultykaypisib-bakitkasyapanunuksokatedraltulisansumusunodhatedistanciahumpaypandidirimaghahabiprovidedsurveyskasinanaymakuhangbirotagaroonduwendealinmahalagasyafriesnapasukoaminyunglearnibililingidpagiisipusuarioiniibigsentencenanahimikkabibimaghatinggabibumabafrogikatlonghaysisikatnoh