Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "great"

1. Cars, airplanes, and trains have made it possible for people to travel great distances in a relatively short amount of time

2. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

3. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

4. I found a great recipe on a cooking website that I can't wait to try.

5. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

6. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

7. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

8. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

9. The Great Barrier Reef in Australia is a wonder of marine life and coral formations.

10. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

11. The Great Wall of China is an impressive wonder of engineering and history.

12. The influence of a great teacher on their students is immeasurable.

13. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

14. The presentation was absolutely flawless; you did a great job.

15. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

16. The website's content is engaging and informative, making it a great resource for users.

17. The website's online store has a great selection of products at affordable prices.

18. They are a great way to use up leftover ingredients and reduce food waste.

19. This can be a great way to leverage your skills and turn your passion into a full-time income

Random Sentences

1. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

2. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

3. Many people think they can write a book, but good writers are not a dime a dozen.

4. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

5. Mi amigo de la infancia vive ahora en otro país y lo extraño mucho.

6. Make a long story short

7. Where there's smoke, there's fire.

8. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

9. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

10. Ang mga dentista ay maaaring mag-rekomenda ng mga produkto na dapat gamitin upang mapanatili ang malusog na ngipin.

11. Natuto akong magluto ng masarap na pagkain kaya masayang-masaya ako ngayon.

12. Isa-isa niyang tiningnan ang mga nakapaligid sa kanya.

13. En invierno, la ropa de invierno, como los abrigos y las botas, está en alta demanda.

14. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

15. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

16. Madalas na mayroong propaganda sa panahon ng digmaan upang mapalawak ang suporta ng mamamayan.

17. Hindi dapat natin kalimutan ang kabutihang loob sa mga taong nangangailangan, samakatuwid.

18. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

19. Ang pagkakaroon ng malubhang sakuna ay binulabog ang buong bansa.

20. Kebebasan beragama dijamin oleh konstitusi Indonesia dan dihormati dalam kehidupan sehari-hari.

21. Hudyat iyon ng pamamahinga.

22. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

23. She has been running a marathon every year for a decade.

24. May luha nang nakapamintana sa kanyang mga mata at ang uhog at laway ay sabay na umaagos sa kanyang liig.

25. She admired the way her grandmother handled difficult situations with grace.

26. Naiinggit ako sa ibang hayop at halaman na tuwang-tuwa kapag may handaan sa kagubatan.

27. Dahil sa pagkabigla ay hindi na nakapagsalita ang binata at ito ay napaluha na lang.

28. Boboto ka ba sa darating na eleksyon?

29. Les employeurs offrent des formations pour améliorer les compétences des travailleurs.

30. Si Maria ay na-suway sa utos ng guro na tapusin ang kanyang takdang gawain.

31. Scientific research has led to the development of life-saving medical treatments and technologies.

32. Nagpatawag ng pagpupulong ang guro sa silid-aralan upang pag-usapan ang mga plano para sa darating na taon.

33. Anong lugar ang pinangyarihan ng insidente?

34. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

35. Kasya kay Suzette ang blusang na ito.

36. Nakatingala siya kay Ogor, mahigpit na kinukuyom ang mga palad.

37. Have they made a decision yet?

38. May gamot ka ba para sa nagtatae?

39. Bilang paglilinaw, hindi ako nagbigay ng pahintulot sa pagbabago ng plano.

40. Gusto ko na talaga mamasyal sa Singapore.

41. Ayaw niyang kumampi sa matatalo kung kaya't ang ginawa niya ay nagmasid-masid muna ito sa di kalayuan at pinanood ang nagaganap na labanan.

42. Work can also have a social aspect, providing opportunities to meet new people and make connections.

43. Ano ang ginawa mo kagabi bago ka matulog?

44. Nasa Pilipinas na si Raymond ngayon.

45. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

46. Ngunit naglahong parang bula si Pinang.

47. The chef created a series of dishes, showcasing different flavors and textures.

48. The relationship between work and mental health is complex and can vary from person to person.

49. Inilagay nya sa poon ang biniling sampaguita.

50. Una conciencia pesada puede ser un signo de que necesitamos cambiar nuestra conducta.

Similar Words

greatergreatly

Recent Searches

piecesgreatheimaglalabamabirobeautypagkainisnagbantaydaramdaminnamataykanikanilangnanlalamigbiologinangangaralbusinesseslinyanakatingalanaghandangnaunabookpag-irrigatekaawaymaninirahanginaganoonmaglalarokumakapalkumukuhawhichpinagkaloobannamumukod-tangikagatolfirstpinagkiskisusuarionag-iimbitapersonalnaglipanangleadanibersaryomerlindapagngitinaninirahanpangungutyamatatalimmagpa-checkupwalkie-talkiepoliticalhintuturonasugatanpinauwidumaloabigaelmatakawkunindilabye11pmskysigpagpasensyahannapakabilismahuhuliumiibigfactorescultivationculturasnananaginippagkagisingmanirahanalapaapnakasahodmag-isangkutsilyomahahanayhinawakanpagkapasokfamemahawaankinikilalangnagandahanpagtataposnagtutulakkagalakankinagalitanemocionantecubiclebigotelalakadasiaartistaskuborightanjosyangpaghangashapingbobotomagpasalamatmamalasnaiisippamumunotv-showsyakapinmagpagupitkidkirankalabawnalalamanmagdilimitutolidea:distansyadeliciosakakaintransparentsurgeryrobertpatiencemasaholngititutusinmilyongrenacentistakampeoncardiganmayamanmarketing:tumamapictureslibresarisaringlargebalikatsakalingnaabottradisyonlever,hinamakgovernorsnakangisingisinusuotinaabotginisingpaglayasdiseaseuniversitiesbumalikginoongnabigaymaluwagnuevosdeathsakenxviicramevissumasambatradepaskongmateryalesmapaibabawkesojobsisasabadika-50hoygiyeragustodependingitinuloscandidatesbayaningjolibeekanilasocietynagtitiisnatalopayapangmetodiskfatcolorsinebulakchickenpoxlayawnatuloghotelpalakaiyakmatipunostreetenglishcosechasbingopalayopopriestnagdarasalmalakihugiscoal