Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "throat"

1. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

2. Tengo dolor de garganta. (I have a sore throat.)

Random Sentences

1. Sa lilim ng kanyang sombrero, tahimik na nagmamasid si Lola habang binabaybay namin ang kalsada.

2. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

3. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

4. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

5. Diyos ko, ano po itong nangyayari sa aming anak?

6. They go to the gym every evening.

7. Oh sige na nga sabi mo eh. hehe.

8. Oh bakit nandito ka pa? ani Maico bilang tugon.

9. Nagulat siya ng makita niya ang isang usa na malapit ng kainin ng isang tigre.

10. Sweetness can be balanced with other flavors to create a harmonious taste experience.

11. Tinutulan ng komunidad ang anumang uri ng abuso laban sa mga kababaihan.

12. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

13. Les écoles offrent des programmes d'apprentissage des langues pour les étudiants.

14. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

15. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

16. Bukas na lang ako pupunta sa bangko.

17. It can be helpful to get feedback from beta readers or a professional editor

18. Ginaganap ang linggo ng wika ng Agosto.

19. Kung walang tiyaga, walang nilaga.

20. Babalik ako sa susunod na taon.

21. Anong gusto mo? pabulong na tanong saken ni Maico.

22. The billionaire was known for his charitable donations to hospitals and schools.

23.

24. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

25. Maramot ang kapitbahay nila at hindi nagpapahiram ng gamit kahit kailan.

26. Ang kanyang galit ay parang nagbabaga, handang sumiklab anumang oras.

27. El nacimiento de un bebé trae consigo la alegría de ver crecer y desarrollarse a un ser humano.

28. Nagtatrabaho ako tuwing Martes.

29. Kaya't iyon ang naging dahilan kung bakit kinamumuhian niya ang kanayang ama at itinuring na patay na ito

30. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

31. Sa kasalukuyang panahon ang bayabas, bukod sa ito ay kinakain o pagkapitas sa puno, ito rin ay ipinansasahog sa ating mga lutuin.

32. Banyak orang Indonesia yang mengajarkan doa sejak usia dini, sebagai salah satu nilai-nilai agama dan moral.

33. El nacimiento de un bebé puede tener un gran impacto en la vida de los padres y la familia, y puede requerir ajustes en la rutina diaria y las responsabilidades.

34. The wedding reception is a celebration that usually follows the wedding ceremony.

35. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

36. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

37. Tengo que tener paciencia para lograr mi objetivo.

38. Hinde pa naman huli ang lahat diba?

39. Gusto ko pumunta, pero pagod na ako.

40. Ang droga ay hindi solusyon sa mga suliranin ng buhay, kundi dagdag pa itong suliranin.

41. Ano ang nasa kanan ng bahay?

42. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

43. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

44. Nakaramdam siya ng pagkainis.

45. Los invernaderos permiten el cultivo de plantas en condiciones controladas durante todo el año.

46. Palibhasa ay may kakayahang magpakatotoo at magpahayag ng kanyang mga saloobin nang malinaw at mahusay.

47. Der er forskellige identiteter inden for transkønnethed, herunder non-binær og genderfluid.

48. Ang bakuna ay lubos na nakakatulong kontra sakit.

49. Nandiyan po ba si Ginang de la Cruz?

50. Ang pagmamalabis sa pagkain ng matataba at malasa ay maaaring magdulot ng problema sa kalusugan.

Recent Searches

throattasao-orderbilanginwednesdayaguaeksportennapagodlaranganothersmaglabaasiaticklasengtelefonwatermangingibignanaymalapitanmakinangsumisidahasbumalikmaasahanhitikbilihinpagkaraacomputere,goalfamelarooperahandisyembrehappenedlegacyhumblekananfatalobstaclestommetodeactinggraceinuminprivateasinbinabaanmerrykaraokenoowaritapatbilugangsalarinlalabilaobingiutilizalaginagtatanongpamanhikanjokepshmoodexcusesnobcupidjoshpopularizefuelkadaratingiilanbroadcastsmakingmulingkasingfourmainstreamdeclaretiyapotentialbabanakasandigpangangatawanlackheypinakamatabangkinikitaprogramsmanggagalingbefolkningen,panamagbabakasyonkayabangankanginai-rechargeinabutanmagtatakajingjingeksempelkirbyhanapinlitsonmonumentolabahinproblemanaghihikabparosentencegownnasusunogkomunidadpalagiyeppaslitgenerationercomuneshelpfullumakingeyecorrectinghimigcnicothingtwofilmpokerpinoynilapitanmariele-commerce,nagdaoslulusogkulisapmagpaniwalamumuranaglipanangtobaccotumawagmerlindanananaginipkonsentrasyonanibersaryopoliticalmagpa-checkupnageenglishpamumunohayaangmagkasabayvideosmagkakaroonmakakibohouseholdsforståtuluyankapangyarihangturismotreatsnaguguluhanmakasilongnakapaligidtinangkangpagtangisgandahannabanggapagkagisingmagtakahurtigerekumirotsenadorenviartrabahonabuhaycompaniesnakainomtinahakgawainghahahasusisisterpeppynasandiyoscapacidadshinesanumangpapayainhaledecreasedfollowingmagkakapatidakmangfavoraayusinmaawaingtradisyonpaakyatbenefitsnagpasanbibilhingasmen