Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

45 sentences found for "madaling makita sa pangubli"

1. Ang mga bata ay nagtatanim ng mga buto upang makita ang proseso ng paglaki ng mga halaman.

2. Ang mga ulap ay nagdulot ng pagdidilim sa buong lugar, kaya't mas nahihirapan akong makita ang aking mga kasama.

3. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

4. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

5. Biglang naalaala ni Aling Rosa ang huli niyang sinabi kay Pina, na sana'y magkaroon ito ng maraming mata para makita ang kanyang hinahanap.

6. Dala ng malakas na pagdidilim, mas lalong nahirapan akong makita ang daan pabalik sa tahanan.

7. Gusto naming makita uli si Baby Janna eh. si Maico.

8. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

9. Hindi dapat asahan na madaling makakuha ng tagumpay kung mailap ang pag-asa.

10. Hindi dapat natin ipagkait ang mga oportunidad na dumadating sa atin, datapapwat ay hindi ito madaling makamit.

11. Hindi lahat ng ating mga pangarap ay madaling makamit, kaya't kailangan nating magpakatatag.

12. Hindi madaling mahuli ang mailap na pag-asa.

13. Isang araw, sa kanyang pagluluto hindi niya makita ang posporo.

14. Kailangan mong lumabas sa iyong kahon upang makita mo ang kaibuturan ng mundo.

15. Kailangan mong mag-isip nang malalim upang makita mo ang kaibuturan ng kanyang problema.

16. Laking pagkamangha ni Aling Rosa ng makita ang anyo ng bunga nito.

17. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

18. Mahirap makita ang liwanag sa gitna ng mailap na kadiliman.

19. Marahil ay hindi magandang ideya na maglakad mag-isa sa madaling araw.

20. Marahil ay nasa ibang bansa ang artista kaya't hindi mo siya maaaring makita sa personal.

21. Marami ang dumarayo hindi lamang para bumili ng mga disenyo kundi upang makita rin ang paggawa ng bata.

22. Maraming tao. Isa pa, baka makita tayo ng girlfriend mo.

23. Nag-iisa siya at tulala sa gitna ng kalsada nang makita ko siya kaninang umaga.

24. Naging masaya naman ang dalawa kahit may kondisyon si Cupid na hindi maaaring makita ang kaniyang mukha.

25. Nagitla ako nang biglang nag-ring ang telepono ng madaling-araw.

26. Nagkaroon siya ng pagkakataon na makita ang kanyang dating kasintahan, ngunit sa halip na bumati, bigla siyang naglimot at nagkunwaring hindi niya ito nakita.

27. Naglabanan sila upang makita kung sino ang tatagal at mananaig.

28. Nagsisipag-uwian na ang mga mababangis na hayop at ibon sa kanikanilang itinalagang mga lugar nang makita nila si Paniki.

29. Nagulat siya ng makita niya ang isang usa na malapit ng kainin ng isang tigre.

30. Nais naming makita ang mga balyena sa malapit na karagatan.

31. Nakalimutan kong magdala ng flashlight kaya nahirapan akong makita sa pagdidilim ng gubat.

32. Nang biglaang magdidilim ang paligid, nahirapan akong makita ang daan pauwi.

33. Nang makita ng manlalakbay ang mga nakasabit na bunga ay bigla niyang naalala ang kanyang gutom at pumitas ng mga ito.

34. Nang makita ng mga kababayan niya ang bunga naghinala silang naroon sa punong iyon ang kanilang gong.

35. Napa wow na lang ako ng makita ko ang kanyang suot na bestida.

36. Napaiyak si Aling Pising ng makita ang mga tuyong kahoy at posporo sa ilalim ng kanilang bahay.

37. Napaluha si Aling Pising nang makita niya ang bunga nito.

38. Napatingin ako sa orasan. 12 na ng madaling araw.

39. Nawalan kami ng internet kaninang madaling araw.

40. Pumasok ako sa isang malaking kuwarto na halos hindi ko makita dahil sa sobrang pagdidilim ng mga ilaw.

41. Puwede makita ang schedule ng biyahe ng bus?

42. Sa bawat tagumpay, dapat nating ipagdiwang ang bawat pagsisikap na ginawa natin, datapapwat ay hindi naman ito palaging madaling maabot.

43. Tara! Sumama ka sa akin para makita mo kung gaano sila kaganda

44. Upang makita niya ang babaing gaganda pa sa sumpa sa kanya, nagdala siya ng ilaw tuwing gabi.

45. Walang bagay na di makita at agad tinatanong ang kanyang ina.

Random Sentences

1. Sumasakay ako ng taksi sa umaga araw-araw.

2. Su obra también incluye frescos en la Biblioteca Laurenciana en Florencia.

3. Eine Inflation kann die wirtschaftliche Ungleichheit verschärfen, da Menschen mit niedrigerem Einkommen möglicherweise nicht in der Lage sind, mit den steigenden Preisen Schritt zu halten.

4. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

5. Matagal ng tradisyon ng mga Pilipino ang pagsamba sa poong Nazareno.

6. La science est la clé de nombreuses découvertes et avancées technologiques.

7. La labradora de mi cuñado es muy ágil y puede saltar obstáculos muy altos.

8. Kung kaagaw ko ang lahat, may pag-asa bang makilala ka?

9. Limitations can be challenging, but they can also inspire creativity and innovation.

10. Tumugtog si Jemi ng piyano kahapon.

11. Nasaan si Trina sa Disyembre?

12. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

13. Have they visited Paris before?

14. Ang mga bayani ay nagtutulungan upang maipagtanggol ang bayan laban sa mga banta at kahirapan.

15. The credit card statement showed unauthorized charges, so I reported it to the bank.

16. They have donated to charity.

17. Lumakad ako nang mag-isa sa madilim na daan at nagitla ako nang biglang may humawak sa aking balikat.

18. No dejes para mañana lo que puedas hacer hoy.

19. Ang pagtawanan at mag-enjoy kasama ang mga kaibigan ay isang nakagagamot na aktibidad.

20. Has he spoken with the client yet?

21. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

22. She opted for a lightweight jacket to wear during her morning run.

23. Ang buhawi ay maaaring magdulot ng malawakang pinsala sa mga ari-arian, gusali, at mga taniman.

24. Eine hohe Inflation kann die Investitionen in die Wirtschaft verlangsamen oder sogar stoppen.

25. Dalawa ang pambura sa silid-aralan.

26. Ako ngayo'y lumilipad at nasa langit na.

27. The guilty verdict was handed down to the culprit in the embezzlement trial.

28. It ain't over till the fat lady sings

29. Hindi dapat natin kalimutan ang ating mga pangarap kahit na may mga pagsubok sa ating buhay.

30. Many cultures have their own unique traditions and customs surrounding weddings.

31. Pano ba yan.. wala ng magkakagusto sa akin kasi mahina ako..

32. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

33. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

34. El cultivo de arroz requiere de un terreno inundado y condiciones climáticas específicas.

35. Naglalaway ang mga bata sa tuwing nakakakita ng mga kendi at tsokolate.

36. Ilang tao ang pumunta sa libing?

37. Omelettes are a popular choice for those following a low-carb or high-protein diet.

38. Las hojas de mi planta de menta huelen muy bien.

39. La Navidad y el Año Nuevo se celebran en invierno.

40. Tienes que tener paciencia para lograr buenos resultados.

41. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

42. Television has a rich history, and its impact on society is far-reaching and complex

43. El invierno es una época del año en la que las personas pasan más tiempo en interiores debido al clima frío.

44. Hello. Ito po ba ang Philippine Bank?

45. Kapag may tiyaga, may nilaga.

46. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

47. La moda de usar ropa estrafalaria está llamando la atención de los jóvenes.

48. I know this project is difficult, but we have to keep working hard - no pain, no gain.

49. Nagtagumpay siya dahil sa lakas ng loob na hinugot niya sa kanyang karanasan sa buhay.

50. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

Recent Searches

alingninapresidentialmalapalasyomarahasfacultypalabasmeronsayalaamangtuyomainitkabuhayannapatungomesahapag-kainanhierbastradisyonelectedtrabahoteacherhumarapkalyenanlilimospaglalayagabonotaoganadeclareunanbakuranbahagyatumaliwaskongzamboangasaranggolamapangasawapalancamasakithawladi-kalayuanviewsboyfriendsino-sinotasanagbibigayankalakisenadorbusbakasyonmaskiniyakaymasungitawang-awaganoonkagatolnakataasbroadcastsnaiilangkaysanitongginoongpronounkaguluhanapolloresultalangbitaminalumalangoyunangnakapagsalitamaiingaykamiaslimatiksumalamanamis-namishagdanankotsesalamangkerasaanpatakbohirapgumisinghagikgiknahawatotoonagpalitpanalangini-googlesaan-saancivilizationrawpanindangkapitbahaykumbentokabosesnamilipitpunotitokinakitaannagtawananmatangpasoksuhestiyonpagdamitumulaknaghubadpagkatakotmasayanag-uumiriyakapkanyarecentnakatitigpilipinasmatalinobatok---kaylamigconsiderarkinatalagangdawnaglalarosandalingganangbukodritomananagotipinatutupadanimoyahitpag-uugalipagsuboknahihirapanexpectationscomputerelangisadditionallysumasagotbagoisinisigawpresentamapayapanag-aagawanjuicenakakatakotbanganag-iisipnaiyakhanap-buhayparisukatadoptedboksingnalulungkotnakatinginhampaslupacomputerlipatgobernadortunayasangalibanganorasimpitpaglalabadabulongsistemadellinggo-linggosiguroeskwelahansalatbumagsaksumalipagkaganda-gandalungsodpag-alagahalagadiseasesparticularnaaksidentekulay-lumotvalleypaskomayabongmagkasinggandade-dekorasyonarmedpabilibinibinisiembralagicedulakumakapitmagpaniwalakauntiagwadorkababayannakakapamasyal