Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "medieval"

1. Desde la época medieval, se han practicado diferentes géneros musicales, como el canto gregoriano y el canto mozárabe

Random Sentences

1. Nagtatrabaho ako sa Student Center.

2. The company lost a lot of money by cutting corners on product quality.

3. Naging malilimutin si Carla mula nang magkasakit siya.

4. Napakabilis ng agaw-buhay na pagbabago sa mundo ng teknolohiya.

5. Napapikit ako at naglabas ng malalim na himutok upang maibsan ang aking pagod.

6. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

7. Gabi na natapos ang prusisyon.

8. May himig pangungutya ang tinig ng pulis.

9. The model on the runway was a beautiful lady who effortlessly commanded attention.

10. Mapayapa ang kanilang lungsod sa pamumuno ng kanilang butihing Mayor.

11. Libre ba si Renato sa Huwebes ng gabi?

12. Ngunit nang dahil sa iyong pagsisisi ay hindi ka pa tuluyang mawawala sa kanila.

13. Ang pagpapabaya sa mga ebidensya at katotohanan ay nagdudulot ng pagkaligaw sa landas ng katarungan.

14. Hindi nakagalaw si Matesa.

15. Napakaseloso mo naman.

16. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

17. L'intelligence artificielle peut être utilisée pour aider à la planification urbaine et à la gestion des transports.

18. Sa ilalim ng malaking puno, natagpuan namin ang lilim na nagbibigay ginhawa mula sa init ng araw.

19. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

20. Crush kita simula pa noong nakita kita sa klase natin.

21. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

22. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

23. Es importante limpiar y desinfectar las heridas para prevenir infecciones.

24. I love to eat pizza.

25. Nasa page 5 ang mapa ng Metro Rail Transit.

26. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

27. Ano-ano ang mga nagbanggaan?

28. Pemerintah Indonesia menghargai dan mendorong toleransi antaragama, mengedepankan nilai-nilai kehidupan harmoni dan persatuan.

29. Ayaw ng nanay kong magtrabaho sa Linggo.

30. Ang aming pamilya ay nagpapahalaga sa konsepto ng bayanihan at palaging handang tumulong sa kapwa.

31. Sa bawat panaghoy ng mga ina, umaasa silang magkakaroon ng katarungan ang kanilang mga anak.

32. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

33. Hindi pa rin matukoy ng mga pulis kung sino ang salarin sa pamamaril sa opisina.

34. Sa muling pagkikita!

35. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

36. Pinigilan nya ang mga kamay ko, Wag!

37. Investors can purchase shares of stocks through a broker or online trading platform.

38. Sa wakas sinabi mo rin. aniya.

39. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

40. I usually like to tell a joke to break the ice at the beginning of a presentation.

41. Portion control is important for maintaining a healthy diet.

42. Me gusta salir a caminar por la ciudad y descubrir lugares nuevos, es un pasatiempo muy entretenido.

43. Il est tard, je devrais aller me coucher.

44. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

45. Nalungkot ang Buto nang dumilim na ang paligid.

46. Traveling to a conflict zone is considered very risky.

47. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

48. Narinig kong sinabi nung dad niya.

49. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

50. Black Panther is the king of Wakanda and possesses enhanced strength, agility, and a suit made of vibranium.

Recent Searches

content,pitoumingitmedievalterminoadversesinapakremainmagdaabrilpeaceelvissenateamparoeffektivmahahabapagodbukodhehehojaskabosestopicrepresentativeincludesalapiuloroughclienteremotenariningworkingnagtutulungansambitinspiredseenanimbowexpectationsledtelevisedshapingmakilingkasinggandabilertogetherlatercomplicatedstrategysaringipinikitpagkatakotsasamahanpamanhikanibinubulongriconasunogkauntimangiyak-ngiyakpag-uwilihimsilaanghelbilanggopassiontigaslazadasantosracialiyakbundokofrecenpinalayasnaiskarganglaruandumilimmayamangmagnifysisidlanarkilalayawanapusaplagasmakikiraanlumipadmabaitandresbigongnamadeletingdatapwatzooiconiccolorlifeinakyatsnobso-calledlikesxixkasoitemseveryspeedcrazyefficientadoptedreguleringkagandaayaflaviosasamastrengthtusindvisdesarrollartsupernakagalawnagbanggaanipinatawaglumiwagkalakihanguhitnamintaga-suportasalbaheinstitucionespasasalamatlamanawateleviewingsinimulannungpopcorntakesmarioestarbagyodiamondmadamigrewminutobrindartuwangbangmalapitusabuwaneliteaywanpagpapasakitmagpuntaginangbinibinibabesmalagoharingisugaexamhanap-buhayipipilittodogandasimplengilingnageenglishpagpapakilalapagkakayakappangungutyanagbabakasyonmagtatagalgumagalaw-galawkalakingbatapandidirikinakabahanpagkapasoktigrehitsurakinauupuangjosephnakakabangonfotostumawagpanghabambuhaykumakantasinasabimedicinesagasaancancergandahanmagsunogmantikanagdabogpananglawtindapaghangakanlurannakatitigmagkasabay