Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "silbing"

1. Nag silbing inspirasyon si Andres Bonifacio laban sa mga inaapi.

Random Sentences

1. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

2. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

3. Skolegang er en vigtig del af børns opvækst og udvikling.

4. Ang boksing ay isa mga sa sports na kinahuhumalingan ng mga Pilipino.

5. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

6. I am not working on a project for work currently.

7. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

8. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

9. Gusto ko ang mga bahaging puno ng aksiyon.

10. He is taking a photography class.

11. La paciencia es clave para alcanzar el éxito.

12. When in Rome, do as the Romans do.

13. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

14. Ang nagbabago ay nag-iimprove.

15. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

16. He was warned not to burn bridges with his current company before accepting a new job offer.

17. Aalis na ko mamaya papuntang korea.

18. Cada año, la cosecha de manzanas en esta región es muy buena.

19. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

20. Nakakabahala ang mga posibleng epekto ng kanilang plano kaya ako ay tumututol.

21. Nasaan si Trina sa Disyembre?

22. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

23. May mahalagang aral o mensahe na ipinakilala sa kabanata, naglalayong magbigay ng kahulugan at kabuluhan sa kwento.

24. For you never shut your eye

25. Baro't saya ang isusuot ni Lily.

26. Nous avons choisi une chanson spéciale pour notre première danse.

27. May kinuha sya sa backpack nya, Dapat gumagamit ka nito.

28. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

29. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

30. May bagong aklat na inilathala ukol kay Manuel Quezon at tungkol ito sa pag-unlad ng teknolohiya.

31. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

32. Kumaripas ng takbo ang aso nang makita ang paparating na sasakyan.

33. Dahan dahan akong tumango.

34. Please add this. inabot nya yung isang libro.

35. Ang pamilya ang sandigan sa oras ng kagipitan.

36. Kahit ang paroroona'y di tiyak.

37. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

38. Si Maria ay nagpasya nang lumayo mula sa kanyang asawa dahil sa patuloy na pisikal na abuso.

39. Mapayapa ang kanilang lungsod sa pamumuno ng kanilang butihing Mayor.

40. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

41. Natapakan ako ni Juliet habang sumasayaw.

42. Si Gng. Cruz ay isang guro sa asignaturang Filipino.

43. Hinanap nito si Bereti noon din.

44. Lazada has a reputation for offering competitive prices and discounts.

45. Einstein was offered the presidency of Israel in 1952, but declined the offer.

46. Huwag na sana siyang bumalik.

47. Pumasok ako sa cubicle. Gusto ko muna magisip.

48. Muchas ciudades tienen festivales de música que atraen a personas de todo el mundo.

49. Maghapon nang nag computer ang kanyang anak.

50. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

Recent Searches

silbingdebatesniyahiwagathercontrolapracticeskasingincreasessecarsebabaareamaaringkabundukanpatricktableracialnasasakupanlumuwaspagsambaenglishgotkargahanpagiisipminerviemagturoshapingnagpakitaexhaustedcosechas1960shelenapublicationjuanjackzgabeespigasrhythmkalongngpuntafreelancerluzlikodkirotkayangsitawmagsi-skiingpoliticssabongcocktailicon1935nangyaristrengthspamakikikainmakatulongoraskampeonpasokkomunikasyonkakuwentuhannakapapasongkumembut-kembotmagkikitarighthinamonmaatimpagkakapagsalitanagmasid-masidclearmagasawangnamumulotnaglipanangnaglalaroiosmakasilongemocionantenagpakunotpamilihanpagdudugotumambadnakataaskinasisindakanmahiyayumabangincluirnapahintokapitbahaynaglaonkamandagnagdadasalvidenskabconservatoriosnagpasamanapawiinaabotcanteenisinaboyalagangpaggawahinintayahhhhnangingitngitpaglayaskatulongkumpunihindespuesbobotoentertainmentsantostagakfederaltiniradormelvinnasusunogmalapitaniniisipkasaysayanwidelyiyanmeanskasolumulusobtreslintamorenapulubibookschildrenhiligmagdabarnesbernardoconnectingboracaypanayglobalpasangbilerexamenchantedbilhinbitawandumatingadditionallyballdaigdigaddresssagingredlockdownbroadslavederevennagkaganitonakakadalawinternainteligentescablestoplightkithapasinnobodymonumentogasolinahanaroundvitalspeedofferwriteeditormanagerpublishedconvertingcontinuegloriacandidatemakuhamariangaanolumampasbagamaabonokaybilisdumaancarolnagniningningmagkapatidpagkahapocellphonebutikilaryngitisbuung-buohundrednangingisaymagpalagomumuntingthese