Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "lives"

1. "Dogs are not our whole life, but they make our lives whole."

2. "Dogs come into our lives to teach us about love and loyalty."

3. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

4. Forgiveness allows us to let go of the pain and move forward with our lives.

5. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

6. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

7. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

8. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

9. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

10. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

11. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

12. Quiero ser una influencia positiva en la vida de las personas que me rodean. (I want to be a positive influence in the lives of people around me.)

13. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

14. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

15. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

16. The dedication of mentors and role models can positively influence and shape the lives of others.

17. The foundation's charitable efforts have improved the lives of many underprivileged children.

18. The pursuit of money can have both positive and negative effects on people's lives and relationships.

19. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Inflation kann auch durch politische Instabilität verursacht werden.

2. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

3. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

4. Nakakatawa? mataray na tanong ko sa kanya.

5. Umalis na si Nicolas patungo sa paaralan.

6. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

7. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

8. Humigit-kumulang sa tatlong daan taong namalagi sa Pilipinas ang mga Kastila.

9. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

10. Hindi maganda ang ugali ng taong nagpaplastikan dahil madalas silang nagsisinungaling.

11. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

12. Mange mennesker bruger påskeferien til at besøge kirkegårde og mindes deres kære.

13. Medyo napalakas ang pag kakauntog nya sa pader.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Kumain na tayo ng tanghalian.

16. Hindi siya maramot sa pagbibigay ng kanyang mga lumang damit sa mga nangangailangan.

17. Les maladies transmissibles peuvent se propager rapidement et nécessitent une surveillance constante.

18. Ano ang nasa bag ni Cynthia?

19. Einstein was born in Ulm, Germany in 1879 and died in Princeton, New Jersey in 1955.

20. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

21. Umiiyak siyang gumuglong sa basa at madulas na semento.

22. Cancer research and innovation have led to advances in treatment and early detection.

23. Madami ka makikita sa youtube.

24. Hindi na sila nasisiyahan sa nagiging asal ng bata.

25. Kailangan nating magsumikap upang makamit ang ating mga pangarap.

26. The company launched a series of new products, targeting different customer segments.

27. Pagtataka ko kung bakit hindi mo pa rin napapansin ang aking mga ginagawa para sa iyo.

28. People can also borrow money through loans, credit cards, and other forms of debt.

29. Sa tulong ng mga batang nagsilapit, ang matanda ay nakatindig.

30. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng kasiyahan at kaganapan sa aking buhay.

31. Madilim ang kweba na kanilang pinasok.

32. Natawa ako sa maraming eksena ng dula.

33. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

34. Seguir nuestra conciencia puede requerir coraje y valentía.

35. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

36. The hospital had a special isolation ward for patients with pneumonia.

37. Hindi maganda na palaging may agam-agam sa buhay, dahil ito ay maaaring magdulot ng stress at anxiety.

38. Malapit na naman ang pasko.

39. Sa kanyang kaarawan, pinuno niya ang kanyang mesa ng mga masasarap na pagkain kaya't ito ay hitik sa mga putaheng lutong-buong.

40. Ang tindera ay nagsusulat ng mga listahan ng mga produkto na dapat bilhin ng mga customer.

41. El ciclo del agua es un proceso natural que involucra evaporación, condensación y precipitación.

42. Si Juan ay nadukot ang cellphone dahil sa isang magnanakaw sa kalsada.

43. Binili ko ang damit para kay Rosa.

44. Ang lakas ng sagap ng wifi sa kanilang bahay.

45. Pinag-aaralan ng mga mag-aaral ang talambuhay ni Ramon Magsaysay bilang isang "Man of the Masses."

46. Tinanong ang kanyang ina kung nasaan ito.

47. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan, at ang pag-aaral na ito ay nagbibigay ng karagdagang kulay sa kanyang karanasan.

48. Sa isang iglap ay nakalabas sa madilim na kulungan ang Buto.

49. "Love me, love my dog."

50. Seeing a favorite band perform live can create a sense of euphoria and excitement.

Recent Searches

pasensyalivestsssmissionheartbreakvivanatulogpeppyejecutanpinagkasundosalatmadurasdiagnosesbukodtaingarailwayssigabalancesdaladalalintabililookediatfbusyangdinalawmulighedmasdannilinistodoterminohearsamfundmedievalconsist1876collectionshesukristomatumalbitbitprotegidocuentandevelopedcompartenphysicalperlakalanrailbumababamemorialpageoliviaroonabikalalakihanmostlikely2001bulastuffedhighbubongtopic,leefistsnilutoshapingbumugaexpertkakainincultivobutolumabannapakalakitinigilanmalaki-lakinakikihalubiloreftungkoltuminginmagtatanimdonationstilamagpapaikotnagliliwanagtandamaramdamansaranggolamisteryosongjeepneyrenaiakargahantatagalnagsisikainnovembermedisinasagabalpanindangmagkamalipagsusulititinanimdaraanansumindifulfillingluboshunipaalisnakakagalahihigafertilizerkasintahannatuyohateextremistsalonpaggawaipapainituniversitiesdalawinrichlungkotkuwentomagandanglarawanmateryalesmarahilhumaloluissumimangotgitnagawasuwailpamanlumiwanagpakisabingitibuwalmagkakapatidnaglalabapaga-alalapoliticallaki-lakisong-writingnapatawagkinapanayamnag-oorasyonkarwahengmahawaaninferioresnagkapilatinirapanselebrasyondadalawinmeriendakinagalitannagsisigawnananaghilipagsalakayweddingkabutihannakakamitpagkainismagpalagomoviekahulugannangangalitpagpanhikmagtataasmumuntingpaumanhinminamahalnagdadasalsiksikanmangahasnagtataeapatnapukontratamakikitulogpagkaraapawiinpagkaangatkinalakihanmagdamagannatinagrodonabowlvidenskabnaghilamosmagagamitmabatongpaparusahaninterests,minatamismakapagempaketumalonafternoonbighaniunanconvey,rewardingfreedoms