Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "lives"

1. "Dogs are not our whole life, but they make our lives whole."

2. "Dogs come into our lives to teach us about love and loyalty."

3. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

4. Forgiveness allows us to let go of the pain and move forward with our lives.

5. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

6. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

7. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

8. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

9. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

10. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

11. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

12. Quiero ser una influencia positiva en la vida de las personas que me rodean. (I want to be a positive influence in the lives of people around me.)

13. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

14. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

15. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

16. The dedication of mentors and role models can positively influence and shape the lives of others.

17. The foundation's charitable efforts have improved the lives of many underprivileged children.

18. The pursuit of money can have both positive and negative effects on people's lives and relationships.

19. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Ako ay nanatili sa iyong pagkatao subalit nagpadala ka mga pagsubok.

2. Siya ho at wala nang iba.

3. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

4. "You can't teach an old dog new tricks."

5. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

6. Yumabong ang pagmamahal ng mga tao sa mga hayop dahil sa mga kampanya para sa kaligtasan ng mga endangered species.

7. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

8. Kung hindi ngayon, kailan pa?

9. Sige ako na ang isa pang sinungaling! Bwahahahahaha

10. May lagnat, sipon at ubo si Maria.

11. Tatanggapin ko po ang anumang kaparusahan.

12. Overall, television has had a significant impact on society

13. Marami ang nahuhumaling sa larong mobile legends.

14. Las plantas trepadoras, como las enredaderas, utilizan estructuras especiales para sujetarse y crecer en vertical.

15. But in most cases, TV watching is a passive thing.

16. Gracias por entenderme incluso cuando no puedo explicarlo.

17. Ang ganda naman ng bago mong cellphone.

18. Einstein's ideas challenged long-held assumptions about the nature of space and time.

19. Hinabol kami ng aso kanina.

20. Waring nag-aalangan siyang pumasok sa silid dahil sa takot.

21. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

22. Nagitla ako nang biglang may kumatok sa pinto.

23. Sa takot ng mga tao sa pagsalakay ng mga tulisan, ibinaon nila ang gong sa isang lugar na malapit sa gubat.

24. Dahil malilimutin ang bata, iniwan niya ang kanyang takdang-aralin sa bahay.

25. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

26. Naglinis kami ng bahay noong Linggo.

27. She complained about the noisy traffic outside her apartment.

28. Mi esposo me llevó a cenar en un restaurante elegante para el Día de los Enamorados.

29. Football is known for its intense rivalries and passionate fan culture.

30. Bawat pamilya ay may magarang tarangkahan sa kanilang mga tahanan.

31. Ang kanyang natatanging abilidad sa musika ay nagdala sa kanya sa internasyonal na kasikatan.

32. Football players must have good ball control, as well as strong kicking and passing skills.

33. Ils ont déménagé dans une nouvelle maison récemment.

34. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

35. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

36. Si Mary ay masipag mag-aral.

37. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

38. They are running a marathon.

39. Higupin ng araw ang tubig-ulan sa kalsada.

40. Madalas na naglulusak sa dumi ang mga bakuran.

41. Alam ko ang kabutihan ng iyong kalooban.

42. Gelai, siya si Tito Maico. sabi ko sabay turo kay Maico.

43. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

44. Las hierbas aromáticas agregan un delicioso sabor a las comidas.

45. I've been taking care of my health, and so far so good.

46. Binisita ako ng aking kaibigan na matagal ko nang hindi nakita kaya masayang-masaya ako ngayon.

47. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

48. Ang aso ni Lito ay mataba.

49. Paglingon niya, nakakita siya sa kanyang tabihan ng isang munting palaka na parang nakatinging sa kanya

50. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Recent Searches

maaariyatawashingtoniyanliveskakapanoodlotcelularesbinatangfameflaviooperahansharkseriousresortreaderssantodalawascientificmalapadindividualtutubuinandamingipanlinisnitongpshfridaywordstheyderesearninggupitpinagtabuyanipinikitcomecoinbaseoffersarilinggracemillionsconditioningschoolpublishingbababinabafascinatingbitawanhimparidevelopmentanuventaimpitknowledgecharitablekitkinagigiliwangpagkapanalosulatpowersmahinangpahingatag-arawnagbabalanag-iisipagawplantarbansapunongkahoyproyektokinakaligligthirdnamanghapinagsulatcosechasbuwisritwal,telebisyonlumusobtumalonpagbubuhatanso-calledlalongkasinewnakabaonnalugmoksapagkatnakumbinsiinakyatpangyayarimakinghadsongtungoespigasmario11pmisaacsenatelaryngitiskabosesipatuloydreammerrynagbasapistainspirationwakasconvey,niyonmaskinermakakaguerreromaya-mayanatutulogpamumuhaypatunayanhugisaffiliatepaksailocostiningnanambagsiglohikingwaterdefinitivobinabalikpulaespadamulicoachingsusunduinprovenathanknow-hownagreplymulressourcernemaglalakadmedya-agwanaglalatangnakikilalangkasalukuyanmurang-murakagabitanggalinnaapektuhanmabihisanproductividadskills,inilalabasiintayinnapakasipagpinapaloparehongnakakasamat-shirtmakangititatlumpungespecializadaskasaganaankwenta-kwentabangladeshpagpasensyahanarbularyoengkantadangsiksikanintensidadpagkaangattumalimkinalilibinganpagamutannagsmileawtoritadongtumahanbecomespalabaspresleycharmingjosephfuryfar-reachingtagpiangkarapatangpinabulaanna-curiousginagawamasaholkuwentopundidoginawaranumiyakafterkapalkinalimutanipinangangaksakoplaganap