Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "hefty"

1. The actor received a hefty fee for their role in the blockbuster movie.

2. The athlete's hefty frame made them well-suited for their position on the team.

3. The backpack was so hefty, it felt like it weighed a ton.

4. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

5. The bag of groceries was too hefty for the elderly woman to carry on her own.

6. The bookshelf was filled with hefty tomes on a wide range of subjects.

7. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

8. The CEO received a hefty bonus for successfully leading the company through a period of growth.

9. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

10. The company's profits took a hefty hit after the economic downturn.

11. The construction of the building required a hefty investment, but it was worth it in the end.

12. The laptop's hefty price tag reflected its powerful specifications and high-end features.

13. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

14. The novel was a hefty read, with over 800 pages.

15. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

16. The package's hefty weight required additional postage for shipping.

17. The professional athlete signed a hefty contract with the team.

18. The restaurant bill came out to a hefty sum.

19. The task of organizing the event was quite hefty, but we managed to pull it off.

20. The teacher assigned a hefty amount of homework over the weekend.

Random Sentences

1. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

2. Nang makita ng manlalakbay ang mga nakasabit na bunga ay bigla niyang naalala ang kanyang gutom at pumitas ng mga ito.

3. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

4. Nakuha ko ang aking dream job kaya masayang-masaya ako ngayon.

5. Ang yaman naman nila.

6. Humihingal na rin siya, humahagok.

7. Ang tag-ulan ay isa sa mga panahon ng taon na nagdadala ng malakas na pag-ulan at kadalasang nagdudulot ng baha at landslides.

8. Bawat isa sa atin ay may malalim na koneksyon sa lahat ng ito, sapagkat ang panitikan ay bahagi ng kultura at buhay ng bawat isa sa atin.

9. Ano pa ho ang dapat kong gawin?

10. Nakita ko ang mga kapatid ko noong pasko.

11. Ano ang kulay ng notebook mo?

12. Kucing dapat dilatih untuk melakukan beberapa trik seperti menjulurkan tangan untuk berjabat tangan atau melompat melalui ring.

13. Ang gusali sa tabi ay mababa kumpara sa bagong itinayong opisina.

14. Ang pagkakaroon ng malakas na lindol ay binulabog ang mga gusali at nagdulot ng takot sa mga tao.

15. Las redes sociales son una parte fundamental de la cultura digital actual.

16. They plant vegetables in the garden.

17. Was du heute kannst besorgen, das verschiebe nicht auf morgen.

18. Nagtapos sya sa unibersidad ng Pilipinas.

19. Gusto ko sanang ligawan si Clara.

20. If you quit your job in anger, you might burn bridges with your employer and coworkers.

21. The company is exploring new opportunities to acquire assets.

22. A través de la música, las personas expresan sus emociones, comparten sus historias y conectan con los demás

23. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

24. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

25. Samantala sa trabaho, patuloy siyang nagpapakasipag at nagsusumikap para sa kanyang pamilya.

26. Ano ang pinabili niya sa nanay niya?

27.

28. Umiling lang ako bilang sagot saka ngumiti sa kanya.

29. He gives his girlfriend flowers every month.

30. Sa pangkat na iyon ay kay Ogor agad natutok ang kanyang tingin.

31. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

32. El nacimiento es el comienzo de una vida llena de aprendizaje, crecimiento y amor.

33. Napapagod ako sa bigat ng poot na umaabot sa aking kalooban.

34. Pinakamatipid kong pagkain ay noodles, pero kailangan ko pa rin ng kubyertos.

35. Tila hindi niya iniinda ang sakit kahit halatang nasasaktan siya.

36. Palibhasa hindi niya kasi malaman kung mahahanay ba siya na isang mabangis na hayop o di kaya'y ibon.

37. Ang dalawang isinumpa ay namuhay sa kakahuyan.

38. Kung walang tiyaga, walang nilaga.

39. Hindi niya gustong maging nag-iisa sa pagpaplano ng kanyang kinabukasan.

40. Paki-drawing mo naman ako ng isang magandang larawan.

41. Sin agua, los seres vivos no podrían sobrevivir.

42. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

43. The hotel room had an absolutely stunning view of the city skyline.

44. The website's design is sleek and modern, making it visually appealing to users.

45. Nakatayo ito sa kanyang tabi at hawak na naman ang kanyang kuwaderno at lapis.

46. Arbejdsgivere tilbyder træning for at forbedre medarbejderes færdigheder.

47. Sumungaw ang payat na mukha ng kanyang asawa.

48. Palibhasa ay may malalim na pag-unawa sa mga komplikadong konsepto at ideya.

49. Ang mga tagapangasiwa sa komunidad ay nag-organisa ng isang pulong upang tanggapin ang mga mungkahi ng mga residente.

50. Las plantas perennes viven durante varios años, renovando sus hojas y flores de forma periódica.

Recent Searches

masterheftyfollowing,pagkasabilumuwaspamumunoblessnaiwanlayuninpinangyarihanenviarnawalakilalaampliatraditionaltsssambagprofoundmagitingenergitoyphilippinehalikajoenobleuntimelyasthmapag-aralingrinsbroadcastboyetsumaliclockelectedpracticeswealtheasylandasinternetkagabinaglulusaktinikmansuriinsubject,kabighasaktannaliligona-suwayhahatolinirapanisulatnagkapilatbiologimiyerkolespag-itimnagpakitakumembut-kembotkwenta-kwentat-shirtnagmungkahimagnakawnagpapasasabagoguitarraumiinompinakidalanalakimahuhusaypakikipagbabagmagagawautak-biyanagbabalamarteskahongmarasiganbwahahahahahanakataasmakakabalikvillagesundalotangekssiyudadhinanakitcover,nakabluenagsilapitnaghilamostennistinataluntonpangako3hrssakopmatulunginasahansumasakayundeniableantesnalamanhigpitanmatangedadnatagalankaninumangjortnilalangcasheleksyonmarielganyantilikakayanankasamalalonglazadabiyasphilosophicalsayawanilagaysurroundingsbumigaykarapatanfulfillingbulaklilyrisenyantamishmmmmsigemininimizesigatiniokinainmembersdogsanimoyanothervocalmesangmadamimedievalpitokaarawanilanghidingmakaratingkasaysayanbipolarbumababachadsumindicallerbaulfaketenderexpertagosconventionalhallitinalisaringnamingbarrierspagsasalitadollarspeechagepreviouslykiloputitabiaddressremotetoolryannamungareleasedbeinginteriorpag-iinatspecialupoexpectationsmakapilingdoingsequeevolvesalapiflashduloattorneymakakatakaspag-aaralassociationpag-iyaknuevopioneermapadalimabutikatolisismo