Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "hefty"

1. The actor received a hefty fee for their role in the blockbuster movie.

2. The athlete's hefty frame made them well-suited for their position on the team.

3. The backpack was so hefty, it felt like it weighed a ton.

4. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

5. The bag of groceries was too hefty for the elderly woman to carry on her own.

6. The bookshelf was filled with hefty tomes on a wide range of subjects.

7. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

8. The CEO received a hefty bonus for successfully leading the company through a period of growth.

9. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

10. The company's profits took a hefty hit after the economic downturn.

11. The construction of the building required a hefty investment, but it was worth it in the end.

12. The laptop's hefty price tag reflected its powerful specifications and high-end features.

13. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

14. The novel was a hefty read, with over 800 pages.

15. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

16. The package's hefty weight required additional postage for shipping.

17. The professional athlete signed a hefty contract with the team.

18. The restaurant bill came out to a hefty sum.

19. The task of organizing the event was quite hefty, but we managed to pull it off.

20. The teacher assigned a hefty amount of homework over the weekend.

Random Sentences

1. Nabalot siya ng kapangyarihan ng abo ni Rodona.

2. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

3. Bawat isa sa atin ay may malalim na koneksyon sa lahat ng ito, sapagkat ang panitikan ay bahagi ng kultura at buhay ng bawat isa sa atin.

4. Mahilig siyang kumuha ng litrato sa oras ng takipsilim.

5. Inflation kann auch durch externe Faktoren wie Naturkatastrophen verursacht werden.

6. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

7. Nagbabaga ang talakayan sa klase habang nagtatalo ang mga mag-aaral tungkol sa isyu.

8. Mas mainit ang panahon kung walang hangin.

9. Hindi natin maaaring iwan ang ating bayan.

10. Nous avons embauché un DJ pour animer notre soirée de mariage.

11. Emphasis is often used in advertising and marketing to draw attention to products or services.

12. Good morning. tapos nag smile ako

13. Yep, basta lang ibibigay mo sakin ang araw mo ngayon.

14. Det er vigtigt at have et støttende netværk af venner og familie under fødslen og i de første måneder efter fødslen.

15. Kailan nangyari ang aksidente?

16. En boca cerrada no entran moscas. - Silence is golden.

17. Naniniwala ka ba sa legend ng academy?

18. El maíz necesita mucha agua para crecer y producir una buena cosecha

19. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

20. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

21. Ang talambuhay ni Manuel L. Quezon ay nagpapakita ng kanyang pagmamahal sa bayan at liderato sa panahon ng kolonyalismo.

22. Lumayo siya sa amin, waring nais niyang mapag-isa.

23. Biglang bumangon ang hari at hinugot ang espada.

24. Itinapon nito agad ang nasabing bunga pagkatikim dahil sa sobrang asim.

25. Magkano ang tiket papuntang Calamba?

26. La tos productiva es una tos que produce esputo o flema.

27. Inakalang wala nang natirang pagkain, pero may tinapay pa pala sa mesa.

28. Ang umuulan nang malakas ay binulabog ang mga kalsada at nagdulot ng matinding baha.

29. Claro, estaré allí a las 5 p.m.

30. People who give unsolicited advice are a dime a dozen.

31. Naghanda kami ng sorpresa para sa kanya.

32. Sa pagguhit, mahalaga ang pagpapakita ng depth at perspective sa mga larawan para maging realistic ang mga ito.

33. Sinundan ito ngunit nawala nang sumuot sa nakausling ugat ng puno.

34. Pagkatapos nyang maligo ay lumuwas na ito ng maynila.

35. Hindi dapat natin pahintulutan ang paglapastangan sa karapatan ng mga mahihina at marhinalisadong sektor ng lipunan.

36. Hindi ko na kayang itago ito - may gusto ako sa iyo.

37. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

38. Nagtapos siya sa kolehiyo noong 1990.

39. He is not running in the park.

40. Sa anong tela yari ang pantalon?

41. Omelettes are a popular choice for those following a low-carb or high-protein diet.

42. Ang kanyang malalim na pangarap ay animo'y imposibleng maabot ngunit patuloy pa rin siyang nagsusumikap.

43. Une alimentation équilibrée et une activité physique régulière sont des éléments clés pour maintenir une bonne santé.

44. Hanggang maubos ang ubo.

45. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

46. Huwag daw niyang papansinin si Ogor.

47. OMG. Makalaglag-panty si Kuya!!

48. May masakit ba sayo?? Ok ka lang ba?

49. Kinuha ko yung CP ko at nai-dial ang number ni Joy.

50. Malaki ang kanilang rest house sa Tagaytay.

Recent Searches

heftypersistent,smallmerenotebookfacecomputerecorrectingpansamantalapagsasalitatalinogumalanakainomlasingeromakakibohealthpayapangformasuccessfulexpertpagbebentamagagandangnauwikaaya-ayangtanyagbestidakakahuyanbakitgabingmabangonaglutomagsasakakubyertosnagpabotplasanakainproducerernogensindepaparusahanmemorynaghubadexcusebilhinrimasactorgawaintilgangadditionawanag-iisaeneroalexanderinyosofaipanliniskwartonagwikangsamebumilipalasyoappagoskatamtamanasiaqualityfallnaligawsinunodsugatangpitongangelaprosesokahaponinfinitymalapadbingitemperaturauniversalnabalitaanpamilyaleftipinikitbusogsasagutinsagingaminfridaypagtatanongsumisidpagkainisogortinangkatraditional1980kaninamapayapapag-unladmapilitangbuhawieroplanoipinahamaksinasabipanalanginpaglalaitmaabutankisapmatatog,yeheyisisingitumiilingedadnakakatakotnamataymakapagsalitamagkaparehonasuklamkapitbahayluhasimplengdividespanindamagamotmaninipishinatidantokrelativelypeacemakabawiipinangangakartepagkakalutomeriendaalasadaptabilitylimitedpwedenghannangingitianmedidaservicescompletamentepantheonkatagaoliviapinagmamasdanfeltpagkaawacompanieskaratulangika-12umiimikkumampinamumulaiiyakcomunesinterpretingchamberseasynagsunuranuulaminikinuwentomahiramkinalimutanmaihaharapletterkitmatalikoffentligmaidcornermalakasmobilenakataasleukemiamainitratepresleypwedepagsisisiibotopagsahodgagawinsinasagotparusahanpasigawtinapaypalayanautomaticjunjunnamasyaltakotgatolpunobabaeputahedumatingmakulitpelikulaespecializadasdagat