Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "hefty"

1. The actor received a hefty fee for their role in the blockbuster movie.

2. The athlete's hefty frame made them well-suited for their position on the team.

3. The backpack was so hefty, it felt like it weighed a ton.

4. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

5. The bag of groceries was too hefty for the elderly woman to carry on her own.

6. The bookshelf was filled with hefty tomes on a wide range of subjects.

7. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

8. The CEO received a hefty bonus for successfully leading the company through a period of growth.

9. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

10. The company's profits took a hefty hit after the economic downturn.

11. The construction of the building required a hefty investment, but it was worth it in the end.

12. The laptop's hefty price tag reflected its powerful specifications and high-end features.

13. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

14. The novel was a hefty read, with over 800 pages.

15. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

16. The package's hefty weight required additional postage for shipping.

17. The professional athlete signed a hefty contract with the team.

18. The restaurant bill came out to a hefty sum.

19. The task of organizing the event was quite hefty, but we managed to pull it off.

20. The teacher assigned a hefty amount of homework over the weekend.

Random Sentences

1. Trump's presidential campaigns in 2016 and 2020 mobilized a large base of supporters, often referred to as "Trumpism."

2. Ang pagbibigay ng ampao ay isang tradisyonal na paraan ng pagpapakita ng paggalang sa matatanda sa Chinese New Year.

3. Nahuhumaling ako sa pagbabasa ng mga self-help books dahil nagbibigay ito ng inspirasyon sa akin.

4. Bilang isang guro, mahalaga ang aking kamalayan sa mga pangangailangan ng aking mga mag-aaral upang magtagumpay sila sa kanilang pag-aaral.

5. Helte kan være en kilde til håb og optimisme i en verden, der kan være svær.

6. Les étudiants peuvent étudier à l'étranger dans le cadre d'un programme d'échange.

7. Limiting alcohol and caffeine intake can improve overall health.

8. Claro, puedes hacer todas las preguntas que quieras.

9. Nationalism is often associated with symbols such as flags, anthems, and monuments.

10. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

11. The patient experienced hair loss as a side effect of chemotherapy for leukemia.

12. Andre helte er stille helte, der arbejder i skyggerne.

13. I have lost my phone again.

14. In the land of Narnia, four siblings named Peter, Susan, Edmund, and Lucy discover a magical wardrobe.

15. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

16. Trump's immigration policies, such as the travel ban on several predominantly Muslim countries, sparked significant debate and legal challenges.

17. Dette er med til at skabe en høj grad af social tryghed for befolkningen, og det er også med til at sikre, at Danmark har en lav arbejdsløshed

18. Wala akong pakelam! Dapat sayo pinapalo!

19. Pinakamatipid kong pagkain ay noodles, pero kailangan ko pa rin ng kubyertos.

20. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

21. Danau Toba di Sumatera Utara adalah danau vulkanik terbesar di dunia dan tempat wisata yang populer.

22. Tuwing biyernes, ginugol niya ang buong araw sa paglilinis at paglalaba ng bahay.

23. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

24. Lapat na lapat sa kanya ang kamisetang iyon noong bagong bili ngunit ngayo'y maluwag na.

25. Sa pagkain ng pulotgata, mahalaga na maghugas ng kamay upang hindi magkalat ang tamis sa ibang bagay.

26. She reads books in her free time.

27. Pabili ho ng isang kilong baboy.

28. El que ríe último, ríe mejor.

29. Tanging si Kablan ang may tindahan sa kanilang komunidad.

30. Inflation bezieht sich auf die allgemeine Erhöhung der Preise für Waren und Dienstleistungen.

31. Kailangan ko ng Internet connection.

32. Dahil sa magandang kwento, hindi ko namalayang nahuhumaling na pala ako sa pagbabasa ng nobela.

33. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

34. Matagal na napako ang kanyang tingin kay Kano, ang sumunod sa kanya.

35. Ah yun ba? Si Anthony, taga ibang department.

36. Ang pagtulog ng maayos ay nagpapabuti sa emosyonal na kalusugan at nagbibigay ng katahimikan at kapanatagan sa puso't isipan.

37. Ang mga estudyante ay pinagsisikapan na makapasa sa kanilang mga pagsusulit upang maabot ang kanilang mga pangarap.

38. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

39. "Tapos na ang laban, wala nang dapat pang pag-awayan," ani ng punong barangay.

40. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

41. Pakibigay sa amin ang detalyeng kailangan para maayos naming magawa ang proyekto.

42. Galing lang ako sa mall. Naggala lang ako.

43. Naglipana ang mga batang naglalaro sa parke ngayong Linggo.

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. Ang pagbasa ng magandang libro ay isang nakagagamot na paraan upang maibsan ang stress.

46. Limitar el consumo de alimentos procesados y azúcares añadidos puede mejorar la salud en general.

47. Baby fever is a term often used to describe the intense longing or desire to have a baby.

48. Magkano po sa inyo ang yelo?

49. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

50. Hinde kasi ako mapakali kaya pumunta ako dito.

Recent Searches

heftylugarnagsibiliemailstonehamhugisideasmitigatelibanganunderholderlupainlolainomminatamispabulongpagtatakanapakabilisibinaonnatinagmagagamitumiyakopisinamanahimikmakapagsabiunahinmanggagalingkarwahengculturallabing-siyamnapapasayatatawagnakakagalasanggolmagsalitahumalakhakgumagalaw-galawpagsasalitajobricokasuutanimbesdomingokasoysumisidbinatilyopalapagnahulaanhitsuranagpasensiyamakakatakasnagtrabahonabalitaanmagbibiyahemusiciannapapalibutantravelerhiwauugud-ugodtagtuyotmasayahinbefolkningen,naiyaknagawangdoble-karapumapaligidbiologimagpalagonamataybulaklakpakikipagbabagpalancapanalanginmaghahatidpinakidalatravelcancercorporationmalulungkotlinggongseguridadlumayomateryalesmagpahabakinasisindakanarbejdsstyrkepambatangsamantalangkapatagankailanmaniniresetamasaholtig-bebeintenabigyanginawangtungoafternoonmagalitrewardingbarcelonakirbydumilatpakibigyantsonggoreorganizing1970sinstrumentalhumigaanungumibigvegasgawanakakapuntamaghatinggabinuevonapakarenaiamedyobinasabigyandyippublishing,magnifynetflixwaterltoanywheremalamigalexanderpulubiasosamakatwidsoccerbalancesiatflintaparosnobbinanggatuwangyeprailwayspitovehiclesmakaratingsalarinarbejderusoelectfakerelomasdancardbasahanipanlinisknownmagdamalapadfelt1980ataquesstoremulmuchasmillionstandababaebotetryghedfridayfrapag-irrigateyonimaginggenerateclearipinalcdhoweverelectronicpressidea:cigarettenapilingyeahefficientgapumarawreadcomputereincreasedmichaelconditioningadobomesamagulangnauntogonline,kayaparagagawin