Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "hefty"

1. The actor received a hefty fee for their role in the blockbuster movie.

2. The athlete's hefty frame made them well-suited for their position on the team.

3. The backpack was so hefty, it felt like it weighed a ton.

4. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

5. The bag of groceries was too hefty for the elderly woman to carry on her own.

6. The bookshelf was filled with hefty tomes on a wide range of subjects.

7. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

8. The CEO received a hefty bonus for successfully leading the company through a period of growth.

9. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

10. The company's profits took a hefty hit after the economic downturn.

11. The construction of the building required a hefty investment, but it was worth it in the end.

12. The laptop's hefty price tag reflected its powerful specifications and high-end features.

13. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

14. The novel was a hefty read, with over 800 pages.

15. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

16. The package's hefty weight required additional postage for shipping.

17. The professional athlete signed a hefty contract with the team.

18. The restaurant bill came out to a hefty sum.

19. The task of organizing the event was quite hefty, but we managed to pull it off.

20. The teacher assigned a hefty amount of homework over the weekend.

Random Sentences

1. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

2. Naramdaman ko ang kanyang malalim na halinghing sa telepono.

3. They knew it was risky to trust a stranger with their secrets.

4. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

5. El powerbank utiliza una batería recargable para almacenar energía.

6. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

7. Nous allons avoir un photographe professionnel pour immortaliser notre mariage.

8. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

9. Marami kaming handa noong noche buena.

10. Pasensiya na kayo, Ale, sabi ng bata.

11. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

12. May basa ng dugo't lupa ang kanyang nguso.

13. Les personnes ayant des motivations différentes peuvent avoir des approches différentes de la réussite.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Gracias por escucharme cuando más lo necesitaba.

16. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

17. Ang hudyat ay isang senyales o tanda na nagbibigay impormasyon o nagpapahayag ng isang ideya o kaisipan.

18. Umikot ka sa Quezon Memorial Circle.

19. Ang mga anak-pawis ay nagtatrabaho sa ilalim ng mahihirap na kondisyon at kailangan ng agarang solusyon sa kanilang mga pangangailangan.

20. A veces tengo miedo de tomar decisiones, pero al final siempre recuerdo "que sera, sera."

21. El arte puede ser utilizado para fines políticos o sociales.

22. The chest x-ray showed signs of pneumonia in the left lung.

23. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

24. Magkano ang isang kilo ng mangga?

25. Naglipana ang mga batang naglalaro sa parke ngayong Linggo.

26. Magkapareho ang kulay ng mga damit.

27. Lazada is an e-commerce platform that operates in Southeast Asia.

28. Me gusta mucho dibujar y pintar como pasatiempo.

29. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

30. I got my sister a cake and wrote "happy birthday" in frosting on top.

31. Halos dalawang linggong nag quarantine ang pamilya ni Josie matapos mag positibo sa covid.

32. Receiving recognition for hard work can create a sense of euphoria and pride.

33.

34. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

35. Sa ilalim ng lumang kahoy, natagpuan namin ang malamig na lilim na nagbibigay ng kapahingahan sa aming paglalakbay.

36. At være transkønnet kan være en udfordrende, men også en berigende oplevelse, da det kan hjælpe en person med at forstå sig selv og verden på en dybere måde.

37. Ang pagtangging harapin ang mga hindi kanais-nais na katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

38. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

39. He has been to Paris three times.

40. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

41. Iniintay ka ata nila.

42. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

43. He was busy with work and therefore couldn't join us for dinner.

44. Ini sangat enak! - This is very delicious!

45. Napuyat na ako kakaantay sa yo.

46. Sa aming mga paglalakbay sa malalayong lugar, natutuwa kami sa mga disenyong mayabong ng mga hardin at parke.

47. Maglalakad ako papuntang opisina.

48. Si Padre Abena ang gusting umampon kay Tony at gusto rin niyang pag-aralin ito

49. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

50. Natagpuan ko ang susi ko sa dakong huli ng aking bulsa.

Recent Searches

heftysmallconstitutionprovidedbowsabadongnakapagsabinagtutulakpagpapatubomagkahawakbaku-bakongagilamaramotmalilimutanmadadalatherapeuticslumutangngumingisikinalalagyantilitatlomaibabalikbanlagkainaninventadoatensyonsumimangotsadyang1960sgabipersonmatikmaninastashowerbagalpinatirapakisabirestawrananabumilibestidaiconsspeechesaffiliatedissenahulisalatmalikottambayancarmenhundredfrescodailyformsmagtipidilawilocosdaladalagoodeveningnunogatherbotanteindustrypanotapewalongindiapatistartumangodatapwatguestsrosesusunduinfreelancericonicrestawantinanggapbaromaritessalarinnewsmayroonfacebookprovemaramicryptocurrencymegetmatangactingfiguressingerlaylaychessexpectationsmovingrolledrightsvariousbosespinag-aralannalugmokkabuntisanpaki-drawingbalitapagpapakilalamagta-trabahomabatongtaglagaskissnakakatabaadvertisingbighanipatawarinlarokumananipagmalaakitibokibonnovembervarietymusicianseksportenlatestcomienzanadicionalesmrsimportanteksaytedhelpfuletopersonsputibeginningwaysresttalebitawanbinabaimprovethemechaverelievedfredgoinglibagmalakingapp4thmitigateipinalutotechnologicalbasaiginitgitmanagerdecreaseandroidbituinneedspaga-alalakinapanayamnakakasamanapatawagisinulatnagpapakainsong-writingobra-maestrapaki-translatenabalitaansalamangkeromagnakawrevolucionadoikinasasabiknagpakitanakatunghaygovernmentmakatulognaapektuhantanggalinumiinommasaksihankalaunantravelihahatidnagtalagamagulayawuugud-ugodmagkaharapnakuhadiscipliner,nakapasokmagkaibangpagkagustonakatalungkohampaslupamagsi-skiingnaiyaknakikianaghuhumindigisasabad