Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "hefty"

1. The actor received a hefty fee for their role in the blockbuster movie.

2. The athlete's hefty frame made them well-suited for their position on the team.

3. The backpack was so hefty, it felt like it weighed a ton.

4. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

5. The bag of groceries was too hefty for the elderly woman to carry on her own.

6. The bookshelf was filled with hefty tomes on a wide range of subjects.

7. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

8. The CEO received a hefty bonus for successfully leading the company through a period of growth.

9. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

10. The company's profits took a hefty hit after the economic downturn.

11. The construction of the building required a hefty investment, but it was worth it in the end.

12. The laptop's hefty price tag reflected its powerful specifications and high-end features.

13. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

14. The novel was a hefty read, with over 800 pages.

15. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

16. The package's hefty weight required additional postage for shipping.

17. The professional athlete signed a hefty contract with the team.

18. The restaurant bill came out to a hefty sum.

19. The task of organizing the event was quite hefty, but we managed to pull it off.

20. The teacher assigned a hefty amount of homework over the weekend.

Random Sentences

1. Ano ang nasa kanan ng bahay?

2. Ang pasyente ay na-suway sa pag-inom ng gamot sa hindi tamang oras.

3. Napadungaw ang ina at kitang-kita niya ang pagkasubasob ng anak bago paman ito nakaakyat ng hagdan.

4. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

5. The victim was able to identify the culprit who had been harassing them for months.

6. Les enseignants peuvent utiliser diverses méthodes pédagogiques pour faciliter l'apprentissage des élèves.

7. Maraming Salamat!

8. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

9. His speech emphasized the importance of being charitable in thought and action.

10. Hindi ako sang-ayon sa pagtrato ng ibang mga tao sa kanilang mga kapwa.

11. Oh, eh bakit naman? tanong naman nung isa.

12. La ingesta adecuada de fibra puede ayudar a regular el sistema digestivo y mantener la salud intestinal.

13. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

14. Mie goreng adalah mie yang digoreng dengan bumbu-bumbu khas Indonesia hingga terasa gurih dan pedas.

15. Lumago ang halaman, yumabong ang sanga hanggang sa ito'y namulaklak at namunga.

16. Ang sugal ay isang bisyong maaaring magdulot ng malaking pinsala sa buhay ng isang tao.

17. Tiyakan ang kanyang pagkakapagsalita; ibig niyang sa pagkalito ng bata sa pag-aapuhap ng isasagot ay masukol niyang buung-buo.

18. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

19. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

20. Claro, puedes hacer todas las preguntas que quieras.

21. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha revolucionado la forma en que las personas se comunican

22. Hinde ka namin maintindihan.

23. Ese vestido rojo te está llamando la atención.

24. Dapat magkaroon ng patas na pagtrato sa lahat ng sektor ng lipunan, kabilang ang anak-pawis.

25. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

26. Hindi dapat natin kalimutan ang ating mga pangarap kahit na may mga pagsubok sa ating buhay.

27. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

28. Thanks you for your tiny spark

29. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

30. The roads are flooded because it's been raining cats and dogs for hours now.

31. Napatingin ako sa orasan. 12 na ng madaling araw.

32. Nasa likod ng aking bahay, natatanaw ko ang bukid na puno ng sariwang mga halaman.

33. Hindi mo aakalaing maarte siya sa mga damit dahil hindi naman ito halata.

34. Kahit na magkaiba kami ng wika, naging magkaibigan pa rin kami dahil sa aming kaulayaw sa isa't isa.

35. It's important to read food labels to understand ingredients and nutritional information.

36. Muntikan na akong mauntog sa pinto.

37. Foreclosed properties can be a good option for those who are looking for a vacation home or second property.

38. Sa mga himig ng kundiman, nadarama ang tibok ng puso at pagkakaisa ng mga Pilipino.

39. Supreme Court, is responsible for interpreting laws

40. La realidad es que necesitamos trabajar juntos para resolver el problema.

41. Nakatira si Nerissa sa Long Island.

42. Huwag kang gagamit ng illegal na droga.

43. El acceso al agua potable es un derecho humano fundamental.

44. Sira ang elevator sa mall, kaya't napilitan silang gamitin ang hagdan.

45. They are not building a sandcastle on the beach this summer.

46. Tila nagbago ang ihip ng hangin matapos ang kanilang pag-uusap.

47. ¿Dónde está el baño?

48. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

49. Das Gewissen kann uns helfen, die Folgen unserer Handlungen besser zu verstehen.

50. Ang masasakit na salitang binitiwan nya ay lubos na nakasakit sa kanyang ina.

Recent Searches

heftysetsanungvidtstraktnapakamotnasasaktanmatulunginrenaiapulongforcessulinganayawpagtatakacornersnakabilimawalananghihinatelephonecardiganpesonagtungonapapalibutanpinagalitannakapapasongnalalaglagnagpakitanagmamaktolnakakatawaeskuwelahannaglalatangaanhinnagkasunogpagpapautangibinubulongnapaluhadisciplinmakakawawamagkaparehokanikanilangkubyertoskamakailanmakatatlominamahalkapamilyamagbabagsikmahiwagangpagkabuhaypalaisipanpanalanginmagkakaroonphilanthropysundalomaipapautangbrancher,perpektingbingipalamutiibinaonkadalasfactoresmabatongdropshipping,nakabibingingsalbahengtahananlandasjulietuniversitiesmaibigaynakabaoneksport,rewardingmakisuyoemocionesmagpakaraminapakalamigvedtamarawlolanatitiyaktungomatumalorkidyasumangatpinansininaabottutusinbandaseryosongkanilaandreahihigitbiglaanmaghapongincrediblegrocerykaraokekinakabahantusongnakainnatakotpagpasokpatongasawaganyanumigiblittlemalasutlanakabiladnuevokinahuhumalinganbayaningtanganmarilounilapitanipagmalaakitawanantondomamarilanumannilalangflamencothroatsagotganitoraciallalongreynamaghahandaguroyoutubeisinumpajobsinasolasiatickatapatisamamatigasnamainiintaynatulogwifihotelarkilamayamangasthmaarguegoalkinantahumblepssstambayankindsmaidbulakimageskakayananggeneeuphoricnagbasaharapkommunikerergrinsalexandersipadahaniatfnakasuotsigafuelmasseslamanpopularizehusobecoming1787effektiv1929nasabingmahahabamedievalmasdanipanlinismalapadindividualmadamisinapakarghpinatidinantokbinawieeeehhhhstevelulusognathaninterestipinabalikumiilingfull-time