Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "book,"

1. A couple of hours passed by as I got lost in a good book.

2. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

3. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

4. Don't underestimate someone because of their background - you can't judge a book by its cover.

5. Format your book: Once your book is finalized, it's time to format it for publication

6. Has she read the book already?

7. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

8. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

9. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

10. I am not reading a book at this time.

11. I am reading a book right now.

12. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

13. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

14. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

15. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

16. Make sure to keep track of your sources so that you can properly cite them in your book

17. Many people think they can write a book, but good writers are not a dime a dozen.

18. Nag-book ako ng ticket papunta sa Ilocos.

19. Promote your book: Once your book is published, it's important to promote it to potential readers

20. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

21. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

22. Sa kasal, ang pagdadala ng mga panulat ay mahalaga upang masigurong makapagsulat ng matatalinong mensahe sa guest book.

23. She has finished reading the book.

24. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

25. The feeling of finishing a challenging book can be euphoric and satisfying.

26. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

27. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

28. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

29. Think about what message you want to convey, who your target audience is, and what makes your book unique

30. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

31. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

32. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

33. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

34. Writing a book is a long process and requires a lot of dedication and hard work

35. You can't judge a book by its cover.

Random Sentences

1. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

2. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

3. Nagbigay ng malaking tulong sa akin ang aking guro sa paghahanda sa aking thesis.

4. Di pa namin napapag-usapan yan 'My.

5. I accidentally let the cat out of the bag about my friend's crush on someone in our group.

6. Dapat bigyang pansin ang kawalan ng seguridad sa trabaho ng mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

7. Maliit ang telebisyon ng ate ko.

8. Hihiga na sana ako nang may kumatok sa pinto.

9. Sumasakay si Pedro ng jeepney

10. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

11. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

12. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

13. Pagputi ng uwak, pag-itim ng tagak.

14. Palagi niyang suot ang kanyang korona upang ipakita na siya ay makapangyarihan.

15. Nanalo siya ng isang milyong dolyar sa lotto.

16. Investing refers to the process of allocating resources with the expectation of generating a profit.

17. La agricultura es una actividad fundamental en muchas regiones del mundo.

18. Un powerbank es un dispositivo portátil que permite cargar dispositivos electrónicos.

19. The bookshelf was filled with hefty tomes on a wide range of subjects.

20. Manahimik ka na nga, tara ng umuwi! Andyan na driver ko!

21. Amazon has a vast customer base, with millions of customers worldwide.

22. Saan nagtapos ng kolehiyo si Peter?

23. Saan siya kumakain ng tanghalian?

24. Give someone the benefit of the doubt

25. Inakalang wala nang pag-asa, pero may dumating na tulong.

26. Ang sabon na may pabangong rosas ay nag-iwan ng mabangong amoy sa aking balat.

27. Niluto nina Tony ang isda sa kusina.

28. But all this was done through sound only.

29. Mura lang ang mga damit sa Greenhills.

30. Ang pagiging maramot ay hindi maganda lalo na kung may nangangailangan.

31. They clean the house on weekends.

32. Scissors have handles that provide grip and control while cutting.

33. Gawa sa faux fur ang coat na ito.

34. Nagtaas na naman ng presyo ang gasolina.

35. Dala ito marahil ng sumpa sa iyo ni Matesa.

36. The existence of God has been a subject of debate among philosophers, theologians, and scientists for centuries.

37. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

38. Nawalan kami ng internet kaninang madaling araw.

39. Eine hohe Inflation kann die Investitionen in die Wirtschaft verlangsamen oder sogar stoppen.

40. Ang yaman naman nila.

41. Huminga ka ng malalim at tayo'y lalarga na.

42. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

43. Umayos ka nga! Wala ka sa bahay!

44. The novel was a hefty read, with over 800 pages.

45. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

46. En casa de herrero, cuchillo de palo.

47. Kumukulo na ang aking sikmura.

48. El flamenco es un género musical y de danza tradicional de Andalucía, con raíces gitanas, que se caracteriza por su intensidad emocional y su riqueza rítmica

49. Sa larong volleyball, ipinasa ni Liza ang bola sa kanyang kakampi.

50. La voiture rouge est à vendre.

Recent Searches

umulanbook,masayangkastilaitinaobkirbynangingisaypaliparincarmendisyembrekuwebanenainimbitakulanglunesbilanggomangingibigcaroldasalgovernmentfonostoreteparopasalamatancombinedsupilinnapatinginkumukulocoalbritishpatunayanmaitimmalapadlamesabalingipanlinisnagdaramdamabriltinanggaphouseyepbusiness,datidraybervotesmarsoaalisbillfridayseekcriticsboksinghamakitinatagposteradvancedsurgerysumangworrydeatheeeehhhhgandafacebookusedsakensafeupworklikelyinilingcomputeredownmapapafuncionareducationalkartonlabanangitanasdatatwoamazonpasinghalinformedstructureaffectmultoumarawexporthalikanpanghihiyangkategori,araw-arawmalasutlakinatatakutanpahiramdeterminasyonbinibilangipakitanakauslingnagsisipag-uwiankagayae-booksbiocombustibleskaugnayanuulaminpagtataposgalitnangangaraltilanapadpadumimikfuncionesresourcescellphonemagtiwalaexpressionsrememberednakatinginbalingandustpanflamencobumangoncashkulisaphumpayfederalandoycirclepag-iinatpinagtagpohumalakhaknanlilimahidnagtatrabahogayunpamansponsorships,unibersidadfotoskapangyarihangsimbahantumawagkagandahannagre-reviewobserverernanghihinaalignskapasyahanmakakakaenmagagawatumatanglawpansamantalaguitarrarevolutioneretnaglakadnakatalungkomasaktanmaghihintaylagnatpagbabantainuulcerpabulongnaglaronagdabogsasakyanunidosbulaktandanginstrumentalpinapakingganbarrerasbinentahansisikatkapatagannagyayangbihirangperyahansinusuklalyansandalingkubyertosmasayang-masayangfollowingakmangpanunuksomensporpagmasdantanyagkapwapadalasmarangalpinilitasawalaamanglupainnanigasadvertisingcommercialsahodmarinigtaksilapitannamamangha