Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "infectious"

1. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

2. Viruses are small, infectious agents that can infect cells and cause diseases.

Random Sentences

1. Ang pasyente ay na-suway sa pag-inom ng gamot sa hindi tamang oras.

2. The patient had a history of pneumonia and needed to be monitored closely.

3. Internal Audit po. simpleng sagot ko.

4. Bawal magpakalat ng mga hate speech dahil ito ay nakakasira ng kalagayan ng mga taong napapalooban nito.

5. Malalaki ang ahas na nakakulong sa zoo.

6. Pinahiram ko ang aking cellphone kay Alex habang inaayos ang kanyang unit.

7. It's not worth getting worked up over - it's just a storm in a teacup.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Elektroniske apparater kan hjælpe med at forbedre kommunikation og forbindelse med andre mennesker.

10. Tengo muchos sueños y aspiraciones. (I have many dreams and aspirations.)

11. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

12. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

13. A veces la realidad es dolorosa, pero no podemos escapar de ella.

14. Hindi naman, kararating ko lang din.

15. The momentum of the protest grew as more people joined the march.

16. Dahan dahan kaming nag lakad. Papapunta sa may.. Sigh.

17. In the dark blue sky you keep

18. Nagsusulat ako ng mga pangalan sa aking kalendaryo upang hindi ko sila malimutan.

19. Before television, most advertising was done through print media, such as newspapers and magazines

20. Laking pagkamangha ni Aling Rosa ng makita ang anyo ng bunga nito.

21. Better safe than sorry.

22. Ngayon lamang ako nakakita ng dugo na kulay abo.

23. He's known to exaggerate, so take what he says with a grain of salt.

24. Ang kanyang mga salita ay nagbabaga ng inspirasyon sa mga nakikinig.

25. Nagpakitang-gilas si Jose sa pamamagitan ng mabilis na pagpasa ng bola.

26. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

27. Les enseignants doivent respecter les normes de sécurité en vigueur dans les écoles pour protéger les élèves.

28. El cordón umbilical, que conecta al bebé con la placenta, será cortado después del nacimiento.

29. El puntillismo es una técnica de pintura que utiliza pequeños puntos de color para crear la imagen final.

30. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

31. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

32. Ariana Grande is also an advocate for mental health awareness, openly discussing her experiences with anxiety and PTSD.

33. Masarap ang pagkakaluto mo ng kare-kare.

34. Agad na kumalat ang balita na may dala si Ana na pagkain, kaya sumugod sila sa bahay ni Aling Rosa.

35. Nagpuntahan ang mga tao roon at hinukay ang ugat ng puno.

36. Einstein's writings on politics and social justice have also had a lasting impact on many people.

37. Ahh.. sinuot na niya to tapos nag patuyo ng buhok.

38. Laging pinapasaya ni Nicolas si Helena kaya tuwang tuwa ang mga magulang nito sa kanya, itinuring na siyang kapamilya ng mga ito

39. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

40. Namamangha at nananaghili sa ganda ng magkakapatid ang mga dalaga sa kanilang nayon.

41. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

42. It's raining cats and dogs

43. Ikinagagalak kong makita ang pag-unlad mo sa buhay.

44. May anim na silya ang hapag-kainan namin.

45. Mahirap magsalita nang diretsahan, pero sana pwede ba kita ligawan?

46. Ang bansa ay hindi lamang sa mga nasa posisyon, kundi sa bawat isa.

47.

48. Das Gewissen kann uns helfen, die Folgen unserer Handlungen besser zu verstehen.

49. Nakakapagod pala umakyat ng bundok.

50. By the way, when I say 'minsan' it means every minute.

Recent Searches

infectiouspaghuhugasbeforesumagotmatagumpaymababatidkumantaresearchparoroonacreationbulongcualquierstudentcontinuesnagtanghalianhonrichkahusayansinampalburgernakakatulongcurrentmagandangmisteryoulopacebitiwanheldsagotmagpaliwanageasiercorporationklimailogeffectgitnaexplaincountriespagkakatumbahousetaga-hiroshimanagpatuloyimbesngayonnag-alalabowtumigilnag-ugatmacadamiapersonskuwadernoimporsponsorships,bumabagiiklikitangkampanamagagandaromanticismomagkipagtagisanhaftmakuhangsakinnatulalamagbibitak-bitakkakilalahigh-definitionbumaligtadyourself,staypinapagulongmunapapuntangkagayadulaplatformspagsigawnamumuongtinapostarcilaoccidentalmakapasoklikelylandesisikataffiliateinilagayevilnaiinismagkasakittransportationtinanggapdispositivostennisnakatagohangaringt-shirtpoliticalmayabangsalarinrockpusongproductividadnakukuhanaglahonag-poutmrsminutomasagananghulimanatiligustong1000lintatextoisinakripisyo2001lawaylalakematangumpaykutoclassroomkisapmatapaghusayansmilekayokasalkailangankagandahananitoinspirasyonpagkaimpaktoinaminhinanapfreeforskelligefencingdraft:cultivationcaraballomaramibutikiumagaclearbumagsakbigkisbeganculturasbaitbabalikalimentoagamulaadvancementsilayrobertadicionalesbibigyantanaw1935matagal-tagalmagpapapagodhalikannaghubadposterkumampiprutasilawkanandiwatamakidalorambutantamangtabing-dagatbiglasumusunodbilernakatiraenterhistoryshouldnagmistulangpandidiribeginningseachprogramsnuevodebateslagnataguatangankaniyatolpilipinaspagpapakalatnagsisikainpracticesalesbatasabi