Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

No sentences found for "g"

Random Sentences

1. Biglang bumangon ang hari at hinugot ang espada.

2. Si Aling Juana ang tagalaba ng pamilya.

3. Ang mga resort sa tabing-karagatan ay puno ng mga turista tuwing summer.

4. Limitations can be overcome through perseverance, determination, and resourcefulness.

5. Mahalaga na hindi tayo mawalan ng pag-asa sa ating mga pangarap.

6. Isang araw, may nanghingi ng kanyang ilang pananim.

7. The patient was discharged from the hospital after recovering from pneumonia.

8. Marmaing sandaling walang nangahas magsalita.

9. Umiiyak ang kanyang mga magulang ngunit alam nilang wala na silang magawa para sa bata.

10. "Palaka?" nagtatakang tanong ng binata

11. Pagkababa, mabilis na siyang nagyayang umuwi.

12. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

13. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

14. Meskipun mayoritas Muslim, Indonesia juga memiliki komunitas yang kuat dari agama-agama lain yang berkontribusi pada keragaman budaya dan sosial.

15. Ang digmaan ay maaaring magdulot ng mga trauma at sakit sa mga biktima at kalahok.

16. Hudyat iyon ng pamamahinga.

17. Sino pa, isisingit ni Ogor, di si Dikyam!

18. Siya ho at wala nang iba.

19. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

20. I'm not impressed with his art. Paintings like that are a dime a dozen.

21. Kapag ako'y nakakapaglaan ng sapat na oras para sa pahinga at pag-aalaga sa aking sarili, ako'y nakakaranas ng isang matiwasay na pamumuhay.

22. Il fait beau aujourd'hui, n'est-ce pas?

23. Ang sugal ay isang hindi makabuluhang pamumuhunan na madalas nawawala ang ininveste.

24. Sa condo ko. nakangiti niya pang sagot.

25. Mabuti pang makatulog na.

26. Para sa kaniya, mas masarap magbasa kapag nag-iisa.

27. Wala nang iba pang mas mahalaga.

28. Ako si Minervie! Ang dyosa ng dagat! Dahil sa kasamaan mo, parurusahan kita! Simula ngayon, hindi ka na maglalakad sa lupa

29. Ang pagpapakilala ng bagong lugar o setting ang nagbigay ng bagong perspektibo sa kuwento sa kabanata.

30. Ituturo ni Clara ang tiya niya.

31. Alas-tres kinse na ng hapon.

32. The artist painted a series of landscapes inspired by her travels.

33. Su vida personal fue complicada y difícil, a menudo luchando con la depresión y la soledad.

34. The telephone has undergone many changes and improvements since its invention

35. You got it all You got it all You got it all

36. At hindi papayag ang pusong ito.

37. Late ako kasi nasira ang kotse ko.

38. Ang aming pamilya ay nagpapahalaga sa konsepto ng bayanihan at palaging handang tumulong sa kapwa.

39. Napansin niya ang takot na takot na usa kaya't nagpasya ito na puntahan ito.

40. May lagnat, sipon at ubo si Maria.

41. Tweets are limited to 280 characters, promoting concise and direct communication.

42. Ang Ibong Adarna ay nagpakita ng magagandang aral tungkol sa katapangan, pagkakaisa, at pagpapatawad.

43. Ang paglapastangan sa mga bata at kababaihan ay isang malaking suliranin sa lipunan.

44. Ang simbahan ay hitik sa mga deboto tuwing Linggo.

45. Les étudiants doivent respecter les règles de conduite à l'école.

46. Hubad-baro at ngumingisi.

47. Maganda ang bansang Japan.

48. Nagpunta ako sa Hawaii.

49. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

50. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

Similar Words

MagkanoangisangngmanggamalakinggustoninyongNagtatrabahoNag-aaralMagandangumagaGinangIkinagagalakkongGuroMgaGngpangalanNagtuturobagpangIlangkutsaritangIyongKaninongpayongkaibiganTaga-OchandoWashingtonLongngayonNegrosbansanglungsodAlingGinoongTaga-HiroshimapulangMagsusuotBarongTagalogtatlongputingsahigalagangilalagaybangkokindergartenhonghinoglangdaangNagtitindasagingnahulogSigeNaglakadpapuntangMaglalakadakongkaratulangLagunaAnonggustongGumisingPagputipag-itimtagakbangpulonggabituwingMagsi-skiingNagbabakasyonNaglaronoongtag-arawginawaginagawaBaguiogagawinpagluluksaLinggoPagkabuhaypagdiriwangGloriaGreenhillsdalawangstoplightMagkaparehopantalongGawaMagkaibaniyangAngelalibongpongMasyadong

Recent Searches

salapinapagodmakapagsabiaplicacionespetspeechesagwadormakapalnariningestilostwomatiyakpassionsandaliflexiblemasayang-masayanapakaalatfratransmitskotsengrestawranhinagismanakbodadanapabook,pagodhinding-hindimatulunginrememberbihasainspirationsatisfactionkahirapansharingjannapanatagkontrahousemarahilsimbahanreserbasyonsweetmapbakasyonpag-aapuhapkungtayosiemprehamonprofoundhangindanzabethdraft:nahahalinhansponsorships,allergycuredmagdadapit-haponbustaosgayadedication,pagkapunopagbabantapetsangagessalatinnagdaanamoynagtaposscottishpamamagitankalikasanmanirahanbiglaandiscouragedpinag-aaralankuborosadonneedbook:democracypaanosinasakyanleaddatimakukulaynagalitfewpamumuhaysaradosorpresastatingnagpuyoshabangpaglalabadakomunidadmabutingupangumiinithellonababakaspondonganaggingsinumanbagkushanapinmatalimjobsmanananggalsummitpanibagongprotestapalamutituhodnapakatakawpalusotdullsumunodlumuwassilamaputitondomatapangisabagcommercemuchoskamustamabaitschedulefrescoluisgradnagbibigaystrengthadditionallyenchantednaglaonlalakiistasyonnawalangkaibiganlendingdeterminasyonnanggigimalmalwaldomakaangalbecomingbisigmilyongumuwikasingcruzlahatibotosandalingsayaaywanpaglalabananaogbarrocopakakasalanipinatawopgavernagwelgapakpaklabananilangrabbaabundantepalaisipankulayipabibilanggosulyapbutterflydrogalabaskaparusahanmadamipinalambotanghelhawlanasaktanbatayipaghugasnagsibilithingikinatatakotpaligidlosrefkinayabedsahasnagpa-photocopy