Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "big"

1. Eh what's the big deal ba? Parang kasama lang kahapon eh.

2. Every year, I have a big party for my birthday.

3. He thought it was a big problem, but in reality it was just a storm in a teacup.

4. Hun er min store forelskelse. (She's my big crush.)

5. I don't like to make a big deal about my birthday.

6. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

7. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

8. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

9. I've got a big presentation at work today - I hope I don't break a leg!

10. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

11. Let's not make this into a big deal - it's just a storm in a teacup.

12. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

13. My son drew a picture of a pretty lady with a big smile.

14. Winning a lottery or a big prize can create a sense of euphoria and disbelief.

15. With the Miami Heat, LeBron formed a formidable trio known as the "Big Three" alongside Dwyane Wade and Chris Bosh.

Random Sentences

1. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

2.

3. La música también es una parte importante de la educación en España

4. Maaari po bang makahingi ng sobra sa hapunan ninyo?

5. Omelettes are a popular choice for those following a low-carb or high-protein diet.

6. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

7. Nakain na nito ang lasong bunga at unti-unti na itong nangingisay at bumubula ang bibig.

8. Bigyan mo naman siya ng pagkain.

9. I have started a new hobby.

10. Magkasamang tutungo sa lugar na walang sakit, walang gutom, walang hirap.

11. Hiramin mo ang aking guitar para mag-practice ng kantang ito.

12. Nood tayong movie. maya-maya eh sabi niya.

13. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

14. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

15. Si Mabini ay naglingkod bilang siyang "Brains of the Revolution" noong panahon ng himagsikan.

16. Dime con quién andas y te diré quién eres.

17. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

18. The bride and groom usually exchange vows and make promises to each other during the ceremony.

19. A father's love and affection can have a significant impact on a child's emotional development and well-being.

20. Ang sugal ay nagdudulot ng pagkawala ng kontrol at pagkakaroon ng mga labis na panganib.

21. Les chimistes travaillent sur la composition et la structure de la matière.

22. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

23. Ang pagkukubli ng mga katotohanan ay nagpapahiwatig ng kawalan ng interes sa realidad.

24. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

25. He is not taking a photography class this semester.

26. I am not watching TV at the moment.

27. Hindi ako sang-ayon sa mga desisyon ng aking mga magulang tungkol sa aking buhay.

28. Sa kabila ng lahat ng pagsubok na dumadating sa atin, ang mga kanta ng Bukas Palad ay patuloy na nagbibigay ng pag-asa at liwanag.

29. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

30. Mabait ang dentista na naglinis ng aking ngipin.

31. I don't think we've met before. May I know your name?

32. Nakita niya ata ako kaya tinigil niya yung pagsasalita niya.

33. Hindi na nakita ni Aling Rosa si Pinang.

34. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

35. Wer im Glashaus sitzt, sollte nicht mit Steinen werfen.

36. ¿Cómo has estado?

37. Umuwi na ako kasi pagod na ako.

38. El arte puede ser interpretado de diferentes maneras por diferentes personas.

39. Ang ganda talaga nya para syang artista.

40. They have been dancing for hours.

41. The stock market is a platform for buying and selling shares of publicly traded companies.

42. Det er vigtigt at give børn en kærlig og støttende opvækst.

43. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

44. Kapag dapit-hapon, masarap mag-jogging dahil mas malamig na ang panahon.

45. Når man bliver kvinde, åbner der sig mange nye muligheder og udfordringer.

46. Kailangan mong bumili ng gamot.

47. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

48. En la realidad, no hay atajos para alcanzar el éxito.

49. Los invernaderos permiten el cultivo de plantas en condiciones controladas durante todo el año.

50. Bumalik siya sa bahay nang tulala matapos mawalan ng trabaho.

Similar Words

kaibiganBibigyanmangingibigtubigNagbigayanpinagbigyanbigkisBigyanPakibigayPakibigyanibigaymagbigaybigasbiglabiglangIbigibibigaynabiglanagbigayBiglaankabighabighaninabigaypagbigyanpag-ibignabighanibibiginiibigpagkabiglamakipagkaibiganumiibigumibigNabigkasbinibigaymagbigayanTibigmaibibigaynaibibigaymaibiganmaibigaymabigyanmagkaibiganbigotetubig-ulanbigongnagbibigaymakapagbigaypabigatnagbibigayanmapagbigaynabigyanAbigaelbigayibinibigaymagbibigaybiggest

Recent Searches

bigminuteoutlinesboksingbagyongdalirihundredcardigankumakalansingpangungutyatindapinakamatabangnagtatakanglalapitnasaannaiinggitlabangeologi,encompasseskinaiinisannakapangasawapaghangaprincipalessay,labisumiibigtuyonakaininintaymachinesyuniigibiniibiginangflavioleadingtheirfialayasmuranglumalakimagpalibrefilmsdinanassakristanmahuhusaypahahanapkumirotnamuhaymasyadongnalamanmakatiginanglalabaahhhhdeliciosasisipainsandalinglangkayofrecenedsapinalayascarriesiyanwalisiniwanreservesbaulverysnanunoparodoublepopulationaddputisaringkitrolledreallyrepresentativepalibhasanag-aalanganlumakasparehongnakapasoksinasadyaedit:nami-missmananagotnapansindireksyonpaglulutomatutongmahigpithuertomakapaibabawmaghahandakasalanannegosyo1950sheartbreakbangkoredigeringtinitirhancentertools,bisigoueumilingkararatinghimhurtigereorkidyaspampagandaniyognamulatmagasawangpalipat-lipatlondonkomedordetkaraniwangsumisidrosellecubicleganitohousereplacedcontestapollodulaahitshouldwebsitecommercelibrolearningandroidpatakbongpanghihiyangtumahimiknakasahodnalalabimamanhikankapatawaranmakitapagtataposfilmartistaswalongfauxhdtvtapenagdarasalilocosginaganoonbumigaydumaanpakilutofameikinatatakotlaki-lakikapamilyaaplicarlindolobra-maestramumuranapatawaghealthiervideos,magkakagustonakitareserbasyongratificante,nakakadalawpaanongnaguguluhanpresence,nawalangbefolkningen,mag-inamanghikayatrevolutioneretnangangarallandlinenakasakitkumalmanapapahintokusinerobeautynag-aabangpinagawanananalongmoviebotehouseholdnakahainnaaksidentenakablue