Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "country"

1. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

2. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

3. Kings may wield absolute or constitutional power depending on their country's system of government.

4. Nationalism can inspire a sense of pride and patriotism in one's country.

5. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

6. Some couples choose to have a destination wedding in a different country or location.

7. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

8. The king's role is to represent his country and people, and to provide leadership and guidance.

9. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

10. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

11. The United States is the third-largest country in the world by land area and the third most populous country in the world.

12. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

13. We admire the courage of our soldiers who serve our country.

Random Sentences

1. Obvious. tawa nanaman sya ng tawa.

2. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

3. Agama juga sering menjadi landasan bagi hukum dan kebijakan di Indonesia, dengan prinsip-prinsip agama tertentu tercermin dalam sistem hukum negara.

4. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

5. Hindi kailanman matatawag na hampaslupa ang mga taong mahihirap ngunit nagta-trabaho ng marangal.

6. Sa bawat kompetisyon, dala ni Hidilyn Diaz ang pagmamalaki at pagmamahal niya sa Pilipinas.

7. Twitter has a set of rules and policies to govern user behavior, including guidelines against hate speech, harassment, and misinformation.

8. Maraming tao ang dumalo upang manood kung mananalo ang matanda sa batang si Amba.

9. Magkita tayo bukas, ha? Please..

10. Ang talambuhay ni Apolinario Mabini ay nagpapakita ng kanyang talino at dedikasyon sa paglilingkod sa bayan.

11. Nagtago kami sa lilim ng malaking bato habang naghihintay sa pagtatapos ng ulan.

12. Sumaya ang mundo ni kuya dahil sa iyo.

13. Sana ay maabot ng langit ang iyong mga ngiti.

14. Claro, estaré allí a las 5 p.m.

15. Parang gusto ko nang magka-baby. pagkuwan eh sabi niya.

16. Natagpuan niya ang singsing matapos niyang salatin ang ilalim ng sofa.

17. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

18. Gusto kong bumili ng bagong cellphone, datapwat ang aking kasalukuyang cellphone ay gumagana pa naman.

19. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

20. Bago matulog, naglalaba ako ng aking uniporme para sa darating na school week.

21. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

22. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

23. The store has a variety of sizes available, from small to extra-large.

24. Sa loob ng maraming taon, pinaunlad niya ang kanyang abilidad sa pagsasalita ng iba't ibang wika.

25. Some people have a sweet tooth and prefer sweet flavors over others.

26. Ilan ang tao sa silid-aralan?

27. Labis kang nasugatan, mabuti pa siguro ay sumama ka sa akin upang magamot ng aking asawa ang iyong mga sugat.

28. Baka matunaw ako. biglang sabi niya. Langya gising pala!

29. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

30. Natawa ang bata ngunit pumayag din ito.

31. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

32. Nagpasya akong tumigil at magpahinga nang magdidilim na ang paligid dahil sa sobrang pagod.

33. Naghahanap ako ng mapa ng bansa para sa aking proyektong pang-geography.

34. Si Dr. John ay isang doktor sa kanilang baryo.

35. Miguel Ángel murió en Roma en 1564 a la edad de 88 años.

36. Wer im Glashaus sitzt, sollte nicht mit Steinen werfen.

37. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

38. Las pinceladas sueltas y rápidas le dan a la pintura un aspecto más dinámico.

39. Tumakbo na ako para mahabol ko si Athena.

40. He is driving to work.

41. Cosechamos los girasoles y los pusimos en un jarrón para decorar la casa.

42. There were a lot of people at the concert last night.

43. May gusto ka bang gawin mamayang gabi?

44. Hinanap nila ang magandang babae upang pasalamatan ngunit wala na ito.

45. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

46. Ako ngayo'y lumilipad at nasa langit na.

47. She has been making jewelry for years.

48. El uso de las redes sociales está en constante aumento.

49. Matagal ko nang pinapaliwanag sa kanila ang mga dahilan kung bakit ako tumututol sa kanilang plano.

50. Napakaganda ng tanawin sa dapit-hapon.

Recent Searches

nagbentacountrykarapatankaramihankapatagansiyudadnagdalavedvarendeisinusuottutusinkandidatoriegabenefitssagotjankaloobanghawlapinamumunuanbighanipaglingonkakataposlarongiparatingintroducehimihiyawhalamananlitostogatheringgayunmanmaibibigayemocionalresearch,mauntogutilizanedukasyonumulanherramientasenergybutasmarieangkopabutandisyembrehundredlimitedbumilideterminasyonphilosophicaldinaluhancigarettepapasachumochosbutterflydejaalas-treshumblegagsounddisposalyumabangtinangkatagumpaystrategymariosellingstarted:sinasabistaplephysicalubodibigkwebalosssensiblecigarettesnamingbluesumugodpropesorprofoundpinansinpinakaindecreaseableedit:spreadmatagumpaytumibaymasaksihannamumutlasinaliksikmabagalnakangisimatagalperseverance,pagiisipcomputertiniklingschoolkamotepresleynanoodjackzpublicationmagtigilcollectionsconsistpagbigyaninangstatingngpuntabangkarawgabetignanhoweverkumakantaroselleikinatatakotcantidadadvertisingmagtagodali-dalinggawaginangpalayanbabescongratsenchantedknow-howspentbinigyangglobalisasyonkapangyarihangalituntuninattorneykinakainibinubulongmahahawaminatamisnagwalisbulamangkukulammahawaannagagandahanbumaligtadgovernmentinaabotnangangalitkahuluganmakasarilinghumigaricohumabolsolarnaglababalangproductividadespigasnagsusulatnapabalikwaspagkamanghanakatitiyaknogensindemakingharaphalamangauthorcrazycornersalarinltomakilingumupomakikitauniversetitongpinsanipinabalikibinibigaymatindingincreaseisinulatprobinsyabinulongmalayangcitizenskongresoputahekapaligiranlokohinaayusinreducednapatulalamadungishugisculturasmamasyalbinato