Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "country"

1. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

2. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

3. Kings may wield absolute or constitutional power depending on their country's system of government.

4. Nationalism can inspire a sense of pride and patriotism in one's country.

5. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

6. Some couples choose to have a destination wedding in a different country or location.

7. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

8. The king's role is to represent his country and people, and to provide leadership and guidance.

9. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

10. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

11. The United States is the third-largest country in the world by land area and the third most populous country in the world.

12. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

13. We admire the courage of our soldiers who serve our country.

Random Sentences

1. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

2. Los héroes son modelos a seguir para las generaciones futuras.

3. The patient had a history of pneumonia and needed to be monitored closely.

4. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

5. The CEO received a hefty bonus for successfully leading the company through a period of growth.

6. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

7. Mahirap magtiis kung mahal mo sya.

8. Sira ka talaga.. matulog ka na.

9. Tim Duncan was a fundamental force in the NBA, leading the San Antonio Spurs to numerous championships.

10. Sumasakit na naman ang aking ngipin.

11. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

12. Nang suriin nila ito ay nakita ang isang insektong kumakain ng kahoy.

13. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

14. The momentum of the athlete propelled him across the finish line.

15. Ano ang tunay niyang pangalan?

16. He's known to exaggerate, so take what he says with a grain of salt.

17. El lienzo es la superficie más común utilizada para la pintura.

18. "Ang hindi lumingon sa pinanggalingan, hindi makakarating sa paroroonan" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pag-alala at pagpahalaga sa mga pinagmulan.

19. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

20. Habang wala pang trabaho ay matuto kang magtiis na asin ang ulam.

21. nakita niya ang naghuhumindig na anyo ni Ogor.

22. Kapag mayroong mga hindi inaasahang pangyayari sa buhay, madalas na nagkakaroon ng agam-agam sa mga tao.

23. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

24. Ang mabuti ho yata, e dalhin na natin iyan kung dadalhin.

25. The telephone has undergone many changes and improvements since its invention

26. Tesla was founded by Elon Musk, JB Straubel, Martin Eberhard, Marc Tarpenning, and Ian Wright.

27. A veces es difícil encontrar buenos amigos, pero cuando los encontramos, vale la pena.

28. Nag-aaral si Maya sa Unibersidad ng Pilipinas.

29. I was going to surprise her, but I accidentally spilled the beans.

30. Amazon's customer service is known for being responsive and helpful.

31. Paglabas niya ng bahay, nabigla siya nang biglang umambon ng malakas.

32. Baka sakaling magbago si Aya kung ito ay isa na ring ina.

33. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

34. Las hierbas medicinales se utilizan desde hace siglos para tratar diversas dolencias.

35. Labis na ikinatuwa ng mag-asawa ang biyayang ito,pangalanan nila ang bata na Rabona, pinaghalo ang pangalan ni Rodona at ang bundok ng Rabba.

36. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

37. Eksportindustrien i Danmark er afhængig af gode handelsaftaler og åbne markeder.

38. Piece of cake

39. Napakahalaga ng talambuhay ni Sultan Kudarat sa pag-unlad ng Mindanao bilang isang lider.

40. Ano ang pangalan ng doktor mo?

41. Sa buong buwan ng Disyembre, ang mga mall ay hitik sa mga pamaskong dekorasyon at mga regalo.

42. Waring nag-aalangan siyang pumasok sa silid dahil sa takot.

43. Napatigil siya bigla at nabitawan yung kamay ko.

44. Masarap at manamis-namis ang prutas.

45. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

46. Maaari ring magdulot ng agam-agam ang pagbabago sa buhay tulad ng paglipat sa ibang lugar o pagbabago ng trabaho.

47. Kagyat na sumagot ang amang nangingitngit, ngunit siya man ay pinagwikaan din ni Aya.

48. Palibhasa ay may kakayahang makipag-usap sa ibang mga tao sa iba't-ibang antas ng kaalaman at pinag-aralan.

49. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

50. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

Recent Searches

gospelmahabangcountrymanilbihannahahalinhanmasarapkindergartenpaliparinkagabinabigaycombatirlas,magsabisementongcramekassingulanginiangatunconventionalabigaelkontraescuelasipinangangakkastilamaskaraaayusingatolwastobroadcastspangangatawanbuwayatawananbagamadadalopaketebutocoughingpokerturonomfattendedeterminasyontinitindateacherkombinationmaingatnilolokotamisexpresanangeladiaperstoapoybingbingconsumemalamangfulfillingpsssanihinbangkobecamehidingproductionblazingpopularizemaistiketmininimizeamopatiindustrymoodsumindibuwanoverallfuelbusiness,siempresnobawanutrientescommunicationsfriespartnersuelobiggestitinalibranchesbinigyangmatalokalikasanreadworkinghulingscaleinteriorvislibagissuesviewsrobertniyaformnagsusulatitemsmemorybituincontrolledmessageflashreturnedmediumcuandonagsisigawpupuntahannagliliyabpagkamagkaparehosistemasnatayomaidmagisingbansangattentionsupremecanadayelopicspalayankahalagapumikitnatalongmayamangneverclientetatanggapinmag-alasmayumingfestivalestinignansussumisidpaymaghatinggabipresencenatutuwaengkantadadalawangmartiancommercialpayapangginoongairplanesarturoumulannatalodalawapagkakatayonagagandahanvirksomheder,pagkalungkotkawili-wilinapaluhapapanhikpinapakiramdamanpagkakalutonagtrabahonakumbinsinagpakitapagpapakilalataong-bayannaglalatangtaga-nayonnaglalakadpinagpatuloypahirapannovellesmabihisaninvestpakakatandaanpagkapasokmakapalagpinagkiskispagtangisnapasigawyumabongpinakabatanginaabutannakatirapanindadispositivolaruinnagagamitmaibibigaynagdabogmagkasakitlalakadmagpagupitsinaliksikmagturolinggongnaiilangitak