Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "country"

1. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

2. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

3. Kings may wield absolute or constitutional power depending on their country's system of government.

4. Nationalism can inspire a sense of pride and patriotism in one's country.

5. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

6. Some couples choose to have a destination wedding in a different country or location.

7. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

8. The king's role is to represent his country and people, and to provide leadership and guidance.

9. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

10. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

11. The United States is the third-largest country in the world by land area and the third most populous country in the world.

12. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

13. We admire the courage of our soldiers who serve our country.

Random Sentences

1. Ang ASEAN Summit ay dinaluhan ng mga pangulo ng iba't ibang bansa.

2. Muchas personas disfrutan tocando instrumentos musicales como hobby.

3. Mabuti na lamang ay sinunod nya ang alituntunin ng kanilang paaralan.

4. Lumipad palayo ang saranggola at hindi na nila nakita.

5. La obra de Leonardo da Vinci es considerada una de las más importantes del Renacimiento.

6. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

7. Ang pag-awit ng mga kanta at pagtugtog ng tradisyunal na musika ay bahagi ng pagdiriwang ng Chinese New Year.

8. Umalis siya sa klase nang maaga.

9. Nagpalipad ng saranggola si Juan sa bukirin.

10. Ang mga anak-pawis ay nangangailangan ng mas mataas na antas ng edukasyon upang umangat sa kanilang kalagayan.

11. Napupuno ako ng poot sa tuwing naaalala ko ang mga pagkakataon na ako'y pinagtaksilan at sinaktan.

12. Hindi na niya napigilan ang paghagod ng kanin sa kanyang plato at naglalaway na siya.

13. In Spanish cuisine, a tortilla española is a thick omelette made with potatoes and onions.

14. May mga taong nagkakaroon ng mga panaginip tuwing natutulog sila.

15. La acuarela es una técnica de pintura que utiliza pigmentos mezclados con agua.

16. Natawa ang bata ngunit pumayag din ito.

17. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

18. Nauna na palang kausapin ni Cupid si Apollo kaya naman siya ang itinakdang mapangasawa ni Pysche.

19. Terima kasih. - Thank you.

20. Mahirap magsalita nang diretsahan, pero ito na - crush kita.

21. Bagkus sa pag-ulan, ang panahon ay mainit at maalinsangan.

22. Los héroes nos inspiran a ser mejores y nos muestran el poder de la bondad y el sacrificio.

23. Give someone the cold shoulder

24. Ate Annika naman eh, gusto ko ng toy!

25. Has he finished his homework?

26. I can't keep it a secret any longer, I'm going to spill the beans.

27. A picture is worth 1000 words

28. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

29. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

30. Sorry hindi kita nasundo. apologetic na sabi si Maico.

31. Nakiisa naman sa kanilang kagalakan ang mga kapitbahay.

32. Paparami iyon at pumapaligid sa kanya.

33. Las serpientes son animales solitarios y, en su mayoría, evitan el contacto con los humanos.

34. The telephone has undergone many changes and improvements since its invention

35. Happy birthday to my best friend, I hope you have a wonderful day!

36. Ang mga bata ay natutong maging responsable sa pamamagitan ng pagsasagawa ng gawaing nagiigib ng tubig sa halamanan.

37. Napagod siya dahil magdamagan ang trabaho.

38. Internal Audit po. simpleng sagot ko.

39. Det har ændret måden, vi interagerer med hinanden og øget vores evne til at dele og få adgang til information

40. Ang tubig-ulan ay maaaring magdulot ng mga sakuna tulad ng baha, landslides, at iba pa.

41. We have been waiting for the train for an hour.

42. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

43. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

44. Naging heneral si Aguinaldo sa edad na 29 sa himagsikan laban sa Espanya.

45. Salatin mo ang pader at hanapin kung saan ang crack.

46. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

47. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

48. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

49. The elderly man was happy sitting on his porch, watching the world go by - sometimes ignorance is bliss in old age.

50. Gusto kong sumama sa nanay ko sa tindahan.

Recent Searches

interests,masasabicountryvibratekonsyertopneumoniaiikotmakalinghumihingiconvey,nagsimulaiikutansakalingmagbabalacapacidadesnagtitinginannasuklamlangkaygjortsugalpauwimanonoodjolibeenapakakumapitnayonditonungcarlobagkusiniintaykatagabateryanasagaanotalagapondopalakapoonghdtvpakilutopriestbinilhanipantalopedsabecamehigh-definitionstohinogtagafakeandamingheardagadilimstaplejudicialallowinghangaringunanfansputaheballeveningprovidebruceamongpocaadverselymonetizingcandidatestagedoonrolledmetodepressipapainitfloorcountriesunopasigawcleankapilingnapilingexampleexportinfinitybetweencablecornerdingdingitlogbathalamatatagpatuloykalalakihanvideos,pagtutolmahigpitmaayosbilangphilippinekamotenag-iyakan1954satisfactionmamanuganginghverawarequicklysteerkanayangomelettegayundinkasonakakalakisampaguitapagpapasakitsugatkalanpangungutyanagsagawaiiyakpaghangamadalinggumandaMalilalakadinireseta1980umiibigmamanhikanmaskianiogsånaantigipinagdiriwangmurangasukalsuloknamaipihitadaptabilityadvertising,larangankategori,pagkalungkotikinabubuhaypinagsikapannagbanggaanhumahangostatawagannapakasipagpagpapatubogayunmannagkakakainkapatawaranmiramalezamagkakaanakposporonagtagisanpinakamagalingmukhatumagalmagtiwalapaghaharutanmensahepamilyadiretsahanguusapannaiyakpagpilimakapalagkalayuannabubuhaypaumanhinkapitbahaytumatakbomagtagohinahanapmarketing:nanangisdadalawminatamisartistmauliniganmaintindihannangyarikanlurantraditionalvegasiniangatmawalaindustriyakaratulangmaghilamosundeniableisinama