Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "country"

1. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

2. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

3. Kings may wield absolute or constitutional power depending on their country's system of government.

4. Nationalism can inspire a sense of pride and patriotism in one's country.

5. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

6. Some couples choose to have a destination wedding in a different country or location.

7. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

8. The king's role is to represent his country and people, and to provide leadership and guidance.

9. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

10. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

11. The United States is the third-largest country in the world by land area and the third most populous country in the world.

12. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

13. We admire the courage of our soldiers who serve our country.

Random Sentences

1. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

2. Sinuspinde ng pulisya ang operasyon sa paghuli ng salarin dahil sa kakulangan ng ebidensiya.

3. Ngayon ang rambutan ay isa sa masasarap na prutas na makikita natin sa ating bansa.

4. Ang pasaway na estudyante ay na-suway nang paulit-ulit ng kanyang guro.

5. Gumagawa ng tinapay si Tito Mark sa kusina.

6. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

7. Yung totoo? Bipolar ba itong nanay ni Maico?

8. Working can provide a sense of purpose, achievement, and fulfillment.

9. Los Angeles, California, is the largest city on the West Coast of the United States.

10. Tumingala siya ngunit siya'y nasilaw.

11. It's nothing. And you are? baling niya saken.

12. We were planning on going to the park, but it's raining cats and dogs, so we'll have to stay indoors.

13. You reap what you sow.

14. Transkønnede personer kan vælge at gennemgå hormonbehandling og/eller kirurgi for at hjælpe med at tilpasse deres krop til deres kønsidentitet.

15. En la realidad, no hay atajos para alcanzar el éxito.

16. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa, tulad ng mga makata at nobelista.

17. Ipinanganak si Hidilyn Diaz noong Pebrero 20, 1991, sa Zamboanga City.

18. Napilitan siyang bumangon at naghanda ng pagkain.

19. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

20. Tesla's Gigafactories, such as the Gigafactory in Nevada, are massive production facilities dedicated to manufacturing electric vehicle components and batteries.

21. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

22. Sumapit ang isang matinding tagtuyot sa lugar.

23. Walang tigil sa paghalakhak ang matanda mula sa kanyang kinatatayuan.

24. Sa dapit-hapon, masarap tumambay sa beach at mag-enjoy sa tubig.

25. Ang ibon ay mabilis na lumipad palayo matapos itong pakawalan mula sa hawla.

26. When life gives you lemons, make lemonade.

27. Sa kanyang harap, pinagmamasdan niya ang mga kumikislap na bituin sa gabi.

28. Maraming Pinoy ang nagta-trabaho sa ibang bansa bilang OFW.

29. Hinahangad ko na makatapos ng yoga session nang hindi naghihingalo.

30. Ang pagiging malilimutin ni Peter ay hindi sinasadya; minsan ito ay dulot ng stress.

31. Kailangan nating magplano upang mas mapadali ang pag-abot ng ating mga pangarap.

32. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

33. The level of sweetness can vary in different types of sugar and sweeteners.

34.

35. Dumating ang bus mula sa probinsya sa hatinggabi.

36.

37. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

38. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

39. Bibisita ako sa lola ko sa Mayo.

40. Inakalang masama ang panahon, pero biglang sumikat ang araw.

41. Medarbejdere kan arbejde på en sæsonmæssig basis, som landmænd.

42. Ang Ibong Adarna ay isang sikat na kwento sa panitikang Filipino.

43. Put all your eggs in one basket

44. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

45. Wala kang sapat na pera para sa bakasyon? Kung gayon, ipagpaliban mo muna ito.

46. I've been driving on this road for an hour, and so far so good.

47. Seek feedback, it will help you to improve your manuscript

48. Más vale tarde que nunca. - Better late than never.

49. Kahit siya ang nauna ay lagi siyang inuunahan ni Ogor sa pagsahod.

50. Women have the ability to bear children and have historically been associated with nurturing and caregiving roles.

Recent Searches

countrybirthdaykaniyaenerotinahakbabespinangalanangobservation,lungsodpapayanetflixmataaastinulak-tulaklittlematapangpaglalaitbahagyakantahanmagawamurang-murabayawakbulakstomagandangpopularhoneymoondamdaminoncesabongipaliwanagnakakainenchantedminatamisrewardingnagbentafeelingexpertnaglabasofadiyosbilibidsumpainspeechnagwaliskahusayanmemorynapapahintokumukulofindeasiergenerabaedit:manipishelloterminojuegossigacanadaantibioticscompanycommunicateataquesmulighederdasalpronounfriendgupitpinagmamalakibrasosalamangkerosellingaanhinnaapektuhaneyekauna-unahangparusapapuntangnangalaglagsellpinakamagalingnicokasalukuyankinagagalakdissenag-oorasyontraditionalhikingfurcapitalhiyaamazonospitalmakakawawadisensyoprintpageclientshawaiiogsåradioginugunitaaniyamorelatesttsismosakuryenteiskedyulintindihinforstålawsnatalongnahigitannglalabakasiyahanwaiteriskolawaytekstvideosmatikmanmanunulatmagdamagkamilipadsenateh-hoyformatkumatokmapapakabosesinilalabasumagangleadmasaganangpampagandasinkmatutuloggiriskelaninilagayvideo18th11pmilan10thnilangfrancisco00amauthorprivatenanaynakayukoforcesagaikinakagalitkinalilibinganliveikinatatakotpaghalikbagalnagpasalamatikinasasabiknakapagsabiugatmakasalanangna-curiouspasukanikinagagalakinformedluluwasnagagandahanpagkakayakapjoywashingtonmagpasalamatnangingitianpinangalanannararamdamanipagmalaakigatheringkikitatiyaalintuntuninpisoaalispedrokasamaangbayadmaitimtakeshinalungkatmatagal-tagalpagkatdagat-dagatanvasquessigawano-anonapakasinungalingnabasaespada