Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "wealth"

1. Investing can be a long-term strategy for building wealth and achieving financial goals.

2. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

3. Money can be saved and invested to achieve financial goals and build wealth.

4. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

5. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

6. The stock market can be used as a tool for generating wealth and creating long-term financial security.

7. This can be a good way to grow your wealth over time, but it also carries risk

8. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Nasa Massachusetts ang Stoneham.

2. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

3. I am exercising at the gym.

4. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

5. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

6. Larry Bird was a versatile forward and one of the best shooters in NBA history.

7. Kumain sa canteen ang mga estudyante.

8. "A dog is the only thing that can mend a crack in your broken heart."

9. Time heals all wounds.

10. Kumain ako ng itlog kaninang umaga.

11. Fødslen kan være en fysisk og følelsesmæssig udfordring for både mor og far.

12. La escasez de agua es un desafío global que afecta a muchas regiones del mundo.

13. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

14. The number you have dialled is either unattended or...

15. Efter fødslen kan der være en følelse af lettelse og glæde over at have en ny baby.

16. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

17. A latte is a popular espresso-based drink that is made with steamed milk.

18. Happy Chinese new year!

19. Gumagawa ng tinapay si Tito Mark sa kusina.

20. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

21. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

22. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

23. Isa sa paborito kong kanta ng Bukas Palad ay "I Will Sing Forever".

24. Magpupunta kami ng hospital mamaya upang magpa-checkup.

25. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

26. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

27. El maíz es uno de los principales cultivos agrícolas en muchos países de América Latina.

28. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

29. Mataaas na ang araw nang lumabas si Aling Marta sa bakuran ng kanilang maliit na barung-barong.

30. Nakita kita sa isang magasin.

31. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

32. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

33. Laging sinusuklalyan ng kaniyang ina na si Aling Pising ang kaniyang buhok.

34. Inalok niya ako ng mga kakanin na hinugot niya sa kanyang tindahan.

35. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

36. He is not taking a photography class this semester.

37. Nang bumukas ang kurtina, lumiwanag ang entablado.

38. El dueño de la granja cosecha los huevos frescos todas las mañanas para su negocio de huevos orgánicos.

39. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

40. Waring nag-aalinlangan siyang sagutin ang tanong ng guro.

41. Ngumiti ako saka humalik sa mga labi niya.

42. Samantala sa kanyang pag-aaral ng sining, nagpapahayag siya ng kanyang mga damdamin sa pamamagitan ng mga likhang sining.

43. Hinawakan ko yung tiyan ko, Konting tiis na lang..

44. Ano ho ang ginawa ng dalawang babae?

45. Busy pa ako sa pag-aaral.

46. La música puede ser utilizada para fines políticos o sociales.

47. Después de estudiar el examen, estoy segura de que lo haré bien.

48. Desde la época medieval, se han practicado diferentes géneros musicales, como el canto gregoriano y el canto mozárabe

49. Napatingin ako sa kanya, Bakit naman?

50. Nang muling lumusob ang higante, pinaulanan nila ito ng pana sa dibdib.

Recent Searches

wealthsumaladenthenakokaringnalamanawtoritadongnagwagilalakadpinapataposnagtatanghalianmataray1000gumagalaw-galawkomunikasyondiyosresignationnagpapakinisconnectpamahalaannanonoodsumungawkwebangpaulit-ulitmaglabadumilatinnovationumangatdisseyumaosadyangipagbilinagawanghigantetelebisyonebidensyamagkanodapit-haponninyoincluirbagsakdahilmuntingnakaraanprutasdahilankinabubuhaykamaygustongkalongchadsarongmagkikitanakapagngangalitsisentapoorerkawili-wilisidogymmeronituturoartistaspagsalakaynabalitaanobra-maestranagpapasasagamesduonlumangoykuwadernotreatsnalalabipinggandiretsahangflyvemaskinerlalabasbwahahahahahacanteenkristokapagnavigationtuladtumamanangapatdannakahainaga-aganawalarewardingpinansinpakibigyanlumusobunosdescargarmaskinernaiwangganitogurokasuutanexpeditedpebrerodumilimforståaffiliatewowkabibibalingulamtapecaraballomangepinalakingvehiclespagodlenguajepatunayandiyanipagtimplanagbasacontrolledniceamingtiketchoosejenaipihitdatatabasinumangplasawarikasolamanlookedbadwhypatakbongcollectionskelanlaganapkinikitabalanceshusopagkasabilabananpersonscigarettebubongbumubulapeteryonapollopakikipagtagposhadescuandosinmonitorboyfriendnagbanggaanairconpananakitsubject,granbinatanggumagamitnaninirahangobernadortinungointensidadkatolikonakaliliyongpresencetatlumpunghindiumagangtransportationmaghintaynatatakotestablisimyentosumasayawsikosapagkatnagtatakapropesorjingjingnasiyahankayanagpakitasarilinapatulalanakatapathayaanabuhinganumangresponsiblepinaghandaanincludingyeareconomytotoong