Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "jerry"

1. Malaya na si Jerry matapos itong makulong ng limang taon.

2. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

Random Sentences

1. Doa juga bisa digunakan sebagai sarana untuk meminta keberanian dan kekuatan menghadapi tantangan hidup.

2. Tahimik ang buong baryo sa takipsilim.

3. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

4. I forgot my phone at home and then it started raining. That just added insult to injury.

5. Many people think they can write a book, but good writers are not a dime a dozen.

6. O sige na nga, diba magkababata kayo ni Lory?

7. Napakabango ng sampaguita.

8. Mahilig sya manood ng mga tutorials sa youtube.

9. Mon mari et moi sommes mariés depuis 10 ans.

10. Muchas personas utilizan las redes sociales para expresar sus opiniones y puntos de vista.

11. Kailangan ko ng lumisan mahal ko.

12. Kapag bukas palad ka, mas maraming taong magmamahal at magtitiwala sa iyo.

13. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

14. Ang taong walang tiyaga, walang magtatagumpay.

15. Sandali lamang po.

16. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

17. The platform has implemented features to combat cyberbullying and promote a positive online environment.

18. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

19. Los adolescentes son especialmente vulnerables al uso de drogas debido a la presión social y la curiosidad.

20. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

21. Ah yun ba? Si Anthony, taga ibang department.

22. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

23. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

24. Uuwi na ako, bulong niya sa sarili.

25. Ang pagkakaroon ng malakas na lindol ay binulabog ang mga gusali at nagdulot ng takot sa mga tao.

26. Maaliwalas ang paligid sa bukid tuwing madaling araw

27. Keep studying and hang in there - you'll pass that test.

28. La conciencia puede hacernos sentir culpables cuando hacemos algo que sabemos que está mal.

29. She has been cooking dinner for two hours.

30. Oh ano 'to?! Sabi ko mansanas diba hindi saging!

31. Pinapagulong ko sa asukal ang kamias.

32. Microscopes are commonly used in scientific research, medicine, and education.

33. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

34. Nagbigayan kami ng mga regalo noong Pasko.

35. Al usar un powerbank, es importante seguir las instrucciones del fabricante para un uso seguro y adecuado.

36. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

37. She lost her job, and then her boyfriend broke up with her. That really added insult to injury.

38. A veces la realidad es dolorosa, pero no podemos escapar de ella.

39. Maraming bagay ang kailangan isaalang-alang sa pagpaplano ng kasal, tulad ng budget at mga bisita.

40. Si Mabini ay isa sa mga pinakamatatalinong lider sa panahon ng himagsikan sa Pilipinas.

41. Si Datu Duri ay matandang-matanda na.

42. Me siento caliente. (I feel hot.)

43. Napakasipag ng aming presidente.

44. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

45. We need to calm down and not let this become a storm in a teacup.

46. Put all your eggs in one basket

47. Habang naglalaba, napadungaw siya sa labas at napansin ang magandang paglubog ng araw.

48. La literatura japonesa tiene una sutileza sublime que trasciende las barreras culturales.

49. Stop crying and pull yourself together, we have work to do.

50. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

Recent Searches

janehumanojerrydoonformsallottedpayongdaddynaroonsarilingkingeyetwinklewealthipipilityoungconventionalfloorinalalayanactingtabasfinishedfanscomunicarsegapexamplekapilingdevelopreallyinterviewingneedsenterwhichmultocablesetsmakesbesidestumatanglawkagatolopisinasalatkapintasangpersonassinakopnakinigphilippinekulaynaglabadakalalakihangeologi,panitikan,kumakalansingbaranggaymahinapagtutoljingjingpaninigastuyokahaponpagkainmagkikitaigigiitmasnauwinaawapangalanantubigtomarfacebookstonehamnunoatinnakaipagbilisatisfactiondaigdigrolledsalapikasakithikingkatagawidelypangalanmagnifybinibilangsacrificetokyodomingoarteganidpinalayasdumilimkakauntognanghihinabutchareasmarteswashingtonlikesalaalapatunayancoalhopepasalamatanrestaurantriyanedsanagpuntasumasakitalituntuninpapuntangnabigyantherapeuticstungonagwalisngitilumipadsignalnatuwasanggolnamuhaymasaktantilgangnatinagpiecesbecomeespigasagadbilugangipaliwanagmeaningisaacweddinginulitwarifionademocracyinantaysinumangoutpostellamamiespadabumugademocraticdrayberpasanpulasusunduinmarchnamingwordsconvertidasipagamotnowginangnagkwentosasayawinnagpaalamnakakagalapagkahapopagpapatubohealthiermalezareserbasyonlumalakikinagalitannaninirahanpagtitiponagricultoresbiocombustiblesnapakasinungalingpoliticalmangpaghaharutanatensyongkalayuannaiilagankumikilosnagdiretsopinaghatidanpinuntahanmahawaannaglakadinaabutansiniyasatmasayahinmakalipasmainitnakahugmagdamagannakasakitsasakyanwatawatkinasisindakanpagkainissinasabiyakapinkahulugan