Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "malamig na inumin"

1. Ang mainit na tasa ng tsokolate ay animo'y nagbibigay init sa malamig na gabi.

2. Ang pagtugtog ng malamig na musika ay nakatulong sa akin na magrelaks at magkaroon ng matiwasay na isip.

3. Ano ang inumin na gusto ni Pedro?

4. Dahil sa tag-ulan, ang temperatura ng panahon ay kadalasang mas malamig at mas nakakapalamig.

5. Gaano ko kadalas dapat inumin ang gamot?

6. Gusto ko ang malamig na panahon.

7. Gusto mo ba ng mainit o malamig na kape?

8. Inumin mo ang gamot nang minsan isang araw.

9. Kapag dapit-hapon, masarap mag-jogging dahil mas malamig na ang panahon.

10. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

11. Malamig sa Estados Unidos kung taglagas.

12. Marahil ay malamig ang klima sa bundok sa panahon ngayon.

13. Masarap mag-surfing sa dapit-hapon dahil mas malamig na ang dagat.

14. Masarap maglakad sa dapit-hapon dahil mas malamig na ang hangin.

15. Naiinitan talaga ako, malamig ba labi mo?

16. Napakainit ngayon kaya't kinailangan kong nagiigib ng malamig na tubig para sa sarili ko.

17. Puwede ba kitang ibili ng inumin?

18. Sa ilalim ng lumang kahoy, natagpuan namin ang malamig na lilim na nagbibigay ng kapahingahan sa aming paglalakbay.

19. Sa malamig ngunit maliwanag nang sikat ng araw, nakikita na niya ang langkay ng mga agwador.

20. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

21. Sa takip-silim, nagiging malamig ang panahon at nakakapagbigay ng komporta sa mga tao.

22. Samantala sa malamig na klima, nag-aalaga siya ng mga halaman sa loob ng bahay.

23. Sinadyang hindi magsuot ng mahal na damit si Juan sa kanyang pamamamanhikan upang magkaruon ng mas malamig na pakiramdam.

Random Sentences

1. Receiving good news can create a sense of euphoria that can last for hours.

2. A couple of weeks ago, I went on a trip to Europe.

3. Inflation kann die Einkommen von Rentnern und Menschen mit festen Einkommen verringern.

4. S-sorry. nasabi ko maya-maya.

5. Nag-aral ng kasaysayan ang estudyante.

6. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

7. Después de ver la película, fuimos a tomar un café.

8. The discovery of cheating can lead to a range of emotions, including anger, sadness, and betrayal.

9. Kulay itim ang libro ng kaklase ko.

10. Kikita nga kayo rito sa palengke!

11. Está claro que la evidencia respalda esta afirmación.

12. Sa tingin ko ay hindi ito magiging epektibo kaya ako ay tumututol sa kanilang desisyon.

13. Les jeux peuvent avoir des règles et des limitations pour protéger les joueurs et prévenir la fraude.

14. Dahil sa mabuti niyang pagtuturo, naging interesado ako sa agham at naging guro rin ako.

15. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

16. You reap what you sow.

17. I can't believe how hard it's raining outside - it's really raining cats and dogs!

18. Está claro que hay diferencias de opinión en este asunto.

19. Hindi mo alam ang kanyang tunay na nais dahil hindi mo alam ang kanyang kaibuturan.

20. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

21. Matitigas at maliliit na buto.

22. Ilang oras na ang nakalipas ngunit hindi pa nauwi ang batang si Ana, nagpatulong na si Aling Rosa sa mga kapit-bahay na hanapin si Ana.

23. Madalas sya nagbibigay ng pagkain sa pulubi.

24. Pagkatapos ng ilang araw, nagbunga ng isang pulang prutas ang puno.

25. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

26. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

27. Binigyan ni Jose ng pera si Bob.

28. Sa mga gubat ng Mindanao, may mga punong-kahoy na may napakalaking kahoy at tinatawag itong "Lauan".

29. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

30. Some scissors have adjustable tension screws that allow users to customize the tightness of the blades.

31. Nasisilaw siya sa araw.

32. Nagtatanim ako ng mga flowering plants upang magkaroon ng magandang tanawin sa paligid.

33. We've been managing our expenses better, and so far so good.

34. Bagsak ang ekonomiya ng Pilipinas matapos ang nangyaring kaguluhan.

35. Sumang ayon naman sya sa mungkahi ng kanyang kasintahan.

36. Ang bato ay hindi mahuhulog kung walang sisidlan.

37. Bumalik ako sa dakong huli para iwan ang aking cellphone na naiwan ko sa table.

38. Ang paggamit ng droga ay hindi lamang nakakapinsala sa kalusugan, kundi pati na rin sa kabuuang pagkatao.

39. Ang pagsusulat ng mga saloobin at damdamin sa pamamagitan ng journaling ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

40. Wag kana magselos, mahal naman kita eh.

41. Buti na lang medyo nagiislow down na yung heart rate ko.

42. Sa harap ng outpost ay huminto ang pulis.

43. Palibhasa ay mahusay sa paglutas ng mga komplikadong mga teknikal na problema.

44. Disse inkluderer terapi, rådgivning og støttegrupper.

45. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

46. Más vale tarde que nunca. - Better late than never.

47. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

48. Tendremos que tener paciencia hasta que llegue nuestro turno.

49. Malapit na ang halalan kaya't nagsulputan na naman ang mga samu't saring pagbati ng mga pulitiko.

50. Mi amigo es un excelente cocinero y siempre me invita a cenar en su casa.

Recent Searches

matangkadkangitanpinagkakaguluhancitizendependpepeyumakapganidpagamutannandayapunoninyotatanghaliinnakikitamassachusettsginilingfinishedplatonatiraiigibriyandingsiembradilawnagpapaniwalacolourmakauwikinakabahankapemagpa-paskopoolbundokpelikulabahagiartesumunodplayedpilipinopag-alagahalagapag-itimmatandakonsultasyonipinagbibilipakikipaglabanlalabhaninaapialituntuninlapisestosisinamapinagsanglaanlimasawacrossjamesmahinapisingnakatigilpresentikinagagalaktungoeksamenlunassantospersonasnakasakaynag-iisangkatotohananmakabilitagalabakondisyonpetkamimaramdamanindividuals1980signfestivalhabangnagdabogalingninapresidentialmalapalasyomarahasfacultypalabasmeronsayalaamangtuyomainitkabuhayannapatungomesahapag-kainanhierbastradisyonelectedtrabahoteacherhumarapkalyenanlilimospaglalayagabonotaoganadeclareunanbakuranbahagyatumaliwaskongzamboangasaranggolamapangasawapalancamasakithawladi-kalayuanviewsboyfriendsino-sinotasanagbibigayankalakisenadorbusbakasyonmaskiniyakaymasungitawang-awaganoonkagatolnakataasbroadcastsnaiilangkaysanitongginoongpronounkaguluhanapolloresultalangbitaminalumalangoyunangnakapagsalitamaiingaykamiaslimatiksumalamanamis-namishagdanankotsesalamangkerasaanpatakbohirapgumisinghagikgiknahawatotoonagpalitpanalangini-googlesaan-saancivilizationrawpanindangkapitbahaykumbentokabosesnamilipittitokinakitaannagtawananmatangpasoksuhestiyonpagdamitumulaknaghubadpagkatakotmasayanag-uumiriyakapkanyarecentnakatitigpilipinasmatalinobatok---kaylamigconsiderarkinatalagang