Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "i dial"

1. Kinuha ko yung CP ko at nai-dial ang number ni Joy.

2. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

Random Sentences

1. Nagitla ako nang biglang nag-crash ang kompyuter at nawala ang lahat ng aking trabaho.

2. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

3. Congress are elected every two years in a process known as a midterm election

4. Un powerbank completamente cargado puede ser una fuente de energía de respaldo en caso de emergencia.

5. Está claro que necesitamos más tiempo para completar el proyecto.

6. La novela de Gabriel García Márquez es un ejemplo sublime del realismo mágico.

7. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

8. Kulay pula ang libro ni Juan.

9. Ang pangamba ay kadalasang sanhi ng hindi pagtanggap sa mga hamon sa buhay.

10. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

11. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

12. Obvious. tawa nanaman sya ng tawa.

13. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

14. Ordnung ist das halbe Leben.

15. Ako ay nagtatanim ng mga puno ng niyog sa aming lupang sakahan.

16. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

17. Sa gitna ng bukid, natatanaw ko ang mga kalabaw na umaararo sa lupang sakahan.

18. ¿Qué planes tienes para el Día de los Enamorados?

19. Sumakay ka sa harap ng Faculty Center.

20. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

21. Sin agua, los seres vivos no podrían sobrevivir.

22. Omelettes are a popular choice for those following a low-carb or high-protein diet.

23. The dancers are not rehearsing for their performance tonight.

24. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

25. Napatingin sila bigla kay Kenji.

26. Ang kagandahan ng sunset sa beach ay animo'y pagpapahinga para sa kaluluwa.

27. Mas mabuti pang magpakatotoo at huwag maging masyadong kababaw sa mga bagay.

28. L'intelligence artificielle peut être utilisée pour aider à la planification urbaine et à la gestion des transports.

29. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

30. Hang in there."

31. Les banques jouent un rôle clé dans la gestion de l'argent.

32. Nag-book ako ng ticket papunta sa Ilocos.

33. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

34. The impact of the pandemic on mental health has been immeasurable.

35. Doble kara ang tawag sa mga balimbing na tao

36. Dahil sa tag-ulan, ang temperatura ng panahon ay kadalasang mas malamig at mas nakakapalamig.

37. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

38. Kailangan ko ng bumalik sa aming kaharian dahil kung hindi ay hindi na tayo muling magkikita pa.

39. Nagsisindi ng ilaw ang mga bahay tuwing takipsilim.

40. Le jeu est une forme de divertissement dans laquelle on mise de l'argent sur un événement aléatoire.

41. Some people like to add a splash of milk or cream to the beaten eggs for a creamier texture.

42. Malalaki ang ahas na nakakulong sa zoo.

43. Sumungaw ang payat na mukha ng kanyang asawa.

44. Ang sugal ay isang bisyong maaaring magdulot ng malaking pinsala sa buhay ng isang tao.

45. Nakita kita kanina, at nagtataka ako kung sana pwede ba kita makilala?

46. Mayroon pa ho sana akong gustong itanong.

47. Leukemia is a type of cancer that affects the blood and bone marrow.

48. Once upon a time, in a faraway land, there was a brave little girl named Red Riding Hood.

49. Nationalism can also lead to authoritarianism and repression of dissent.

50. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

Recent Searches

salaminnakangisinghinanakitnaglaonnaaksidentepagbebentanagpalutokumapitnapatawagkalakihannagsusulatubokinatatakutannakaupogayunmanlamangshareviewsparatingpowersnamemakilingmetodeouttripmatabaintroducemagpasalamatpagtungonapasubsobmakauwimakabawikaninumantutungonakahugtumunoglandlinetinakasanfindtibigalasfatherparehasmasarapmayamangangelaestatesantoskenjiordermahinogpinapatapospagtinginnovellesmagdoorbellnalugmokmakuhangibinibigayhahatolnagpagupitpaanongpamahalaanpalabuy-laboyinakalangmagagandanglumiwagnakakasamapagsalakaykagalakanmagsimulagaanoydelsercurtainsabutanendvideretenidocaraballoengkantadahinatidhawlagatolmusicbighaninaguusapdepartmentindustriyatienengovernorsgagpigingjocelynlumilingoneclipxeklasengkabuhayanaksidentesoundlimitedanihingoodeveningcomunicantapekatedralhiningibinulongpasalamatanwalongpogikingdomdiscovereddelpantheoninfectioushurtigerevantelangmaskmallawaclasespetsangsweetmorenamrsibonresumenpinalalayasbarriersdogdeathmatindingdyandraybersystematiskexammisusednuonspeechesrefdumaramivisualulingautomaticeffectscreatinghulingtermfallaibigisinuotideaprimerhospitalkilalang-kilalacurrentunattendedoperahandiplomabritishmahusayteknologimariangtilaalas-diyestransport,omelettehimihiyawlibroreturnedmedikalbasketparaangcosechasmassachusettsnilayuancompostsampunghinamakmabangisinagawinlovemahinangmakasalanangniyaradioiglapmukhanagbiyayahinawakannakaririmarimbeforeaksiyonumingitnababalotmasiyadosumusunoearnsipagkasinggandasambit